SecReT6
Protein ID: 378978459
SecReT6 ID548
T6SS typei2
Gene symbol-
Locus tagKPHS_23000
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]2329665..2330354 [+]
Producthypothetical protein
NoteTssL
UniProt IDG8VZH8
KEGG IDkpm:KPHS_23000
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.60E-38, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|378978459|ref|YP_005226600.1| hypothetical protein KPHS_23000 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MNEPKRGNAASIDIDALLQNTWLQVISLRHGPQFRDEEGYTLWQRCIADVERVQHELKASGLDDVSCQHI
LTAQCALLDEAVKGRGVEDEACLQWYDIPLQGHFLGTMDAGDTLCERMRDVLREPAPNLAVVTCFQRVML
LGFIGSFRSLHDPERLKLVNALGERVPPFQCPATAPVLVESRAGLGISGWLAPWPVRIGLSVVVVLALWW
GLNHWLDHLLLTLLPGEVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|378976159|ref|NC_016845.1|:2329665-2330354 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
GTGAATGAGCCTAAACGCGGCAACGCCGCGTCCATTGATATTGATGCGCTGCTGCAGAACACCTGGCTGC
AGGTTATCAGCCTGCGCCACGGCCCGCAGTTCCGCGATGAGGAAGGGTACACGCTATGGCAGCGCTGTAT
TGCTGATGTCGAGCGCGTGCAACATGAGCTGAAGGCGAGCGGGCTTGATGACGTCAGCTGTCAGCATATT
CTCACCGCCCAGTGCGCGCTGCTCGATGAAGCAGTGAAAGGTCGCGGCGTGGAGGATGAGGCCTGCCTGC
AGTGGTATGACATTCCGCTGCAGGGGCACTTCCTCGGCACCATGGACGCCGGCGACACCCTGTGCGAGCG
GATGCGTGATGTGTTGCGTGAACCGGCGCCCAACCTGGCCGTGGTCACCTGTTTTCAGCGGGTGATGCTG
CTGGGTTTTATTGGCAGCTTTCGCTCCCTCCACGACCCCGAGCGCCTGAAGCTGGTCAACGCGCTCGGTG
AGCGTGTTCCTCCTTTTCAGTGCCCGGCTACCGCTCCCGTACTGGTAGAGAGTCGCGCCGGTCTGGGGAT
AAGCGGCTGGCTGGCCCCATGGCCGGTACGTATTGGCCTGAGCGTGGTGGTGGTACTCGCCCTGTGGTGG
GGACTCAACCACTGGCTCGATCACCTGCTGCTGACCTTGTTACCGGGGGAGGTGAAATGA