SecReT6
Protein ID: 378978460
SecReT6 ID548
T6SS typei2
Gene symbol-
Locus tagKPHS_23010
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]2330351..2332057 [+]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDG8VZH9, G8VZH9
KEGG IDkpm:KPHS_23010
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.60E-16, Aligned region: 148..159
OmpA [PF00691], Evalue: 4.60E-16, Aligned region: 438..534
DUF4131 [PF13567], Evalue: 0.00074, Aligned region: 8..75
DUF4131 [PF13567], Evalue: 0.00074, Aligned region: 319..352
Protein Sequence: 568 a.a.     [Download]
>gi|378978460|ref|YP_005226601.1| OmpA/MotB domain-containing protein [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MSPPQQRGLALWASLLSALVCLLFLPVPRWGAWLILLVTLALIIGIWRIASRRTGRNVASTLAPLPEGAY
RQPVVLVCGDLPCVWPQASPVRVVKQGCWIRVEKTEELQQVARQVLSQRPEWGPQLSVLLCVCPQRHAQS
DALTSALLALRWQLSQLRQQTGYAVPLVLQGQVGSAMSRDLLWQAAIPGEAVKVWQPSCAPCSVPAWVSA
GGAAALEQQVLMNSLMGWFEQHVHAVLTEENTDLPPLTPAAVLWGLGPSLPGRLASSAWTTWLSRHSGLS
RVAGWQPDESDTGDASALPELILPQLPVGRGLTPRGRAWRAALAIFTLAAVAALLSSGWNNRQLLQRVSV
DIARYERIAMDDYRPKASAVRVLREDAALLDSWARNGVPLRLSLGLYHGEQIRLPLLEAIRGYVPPPPPP
RPVQRVAPDVIRLDSMSLFDTGKWVLKPGSTKRLVSSLMDIKARPGWLIVVAGHTDSVGEEKANQLLSLK
RAESVRDWMRDTGDVPDSCFAVQGYGESRPIATNDTPEGRALNRRVEISLVPQVDACRLPDQPSASSQDD
GASLHNGE
 
Nucleotide Sequence: 1707 bp     [Download]
>gi|378976159|ref|NC_016845.1|:2330351-2332057 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAGCCCCCCGCAGCAGCGTGGGCTGGCGCTGTGGGCCAGTCTGCTGAGTGCGCTGGTGTGCCTGCTAT
TTTTGCCGGTTCCCCGCTGGGGGGCGTGGCTCATTCTGCTGGTCACGCTGGCCCTGATCATCGGGATCTG
GCGCATCGCCAGTCGTCGTACCGGACGTAACGTCGCATCAACCCTGGCCCCTCTCCCGGAGGGCGCTTAT
CGCCAACCGGTGGTCCTCGTTTGCGGCGACCTGCCGTGTGTCTGGCCGCAAGCGTCACCGGTGCGAGTGG
TCAAACAGGGCTGCTGGATCCGCGTGGAAAAGACGGAGGAGCTGCAGCAGGTCGCGCGCCAGGTATTGAG
CCAGCGGCCGGAATGGGGGCCTCAGCTGTCGGTGCTGCTCTGCGTCTGCCCGCAGCGGCATGCGCAAAGC
GATGCGCTGACCAGCGCTCTGCTGGCCCTGCGCTGGCAACTCAGCCAGCTGCGCCAGCAGACGGGGTATG
CCGTACCGCTGGTGCTGCAGGGGCAGGTGGGCAGCGCGATGAGTCGCGACCTGTTGTGGCAGGCGGCGAT
ACCGGGTGAAGCGGTGAAAGTCTGGCAGCCCTCCTGCGCCCCCTGTTCCGTACCGGCCTGGGTAAGCGCC
GGTGGGGCGGCCGCGCTGGAGCAGCAGGTGCTGATGAACAGCCTGATGGGCTGGTTTGAACAGCACGTCC
ATGCCGTGTTGACGGAAGAGAATACCGACCTGCCACCTCTGACCCCTGCGGCCGTGCTGTGGGGCCTCGG
GCCCTCGCTGCCTGGAAGGCTGGCATCGTCGGCCTGGACGACGTGGTTATCCCGACATAGCGGCCTGTCG
CGGGTAGCTGGCTGGCAGCCAGATGAGAGCGACACCGGGGACGCTTCAGCTTTGCCGGAATTAATCCTGC
CGCAGTTACCGGTGGGACGGGGACTCACGCCACGAGGCAGGGCCTGGCGAGCGGCGCTCGCGATTTTCAC
CCTCGCGGCTGTCGCCGCGCTGCTCAGCAGTGGCTGGAACAATCGACAACTGCTGCAGCGCGTGAGCGTC
GATATTGCCCGTTATGAGCGGATTGCGATGGATGATTATCGACCAAAAGCCAGCGCTGTCAGGGTGCTGC
GTGAAGATGCCGCGCTGCTTGATAGCTGGGCGCGTAACGGCGTCCCGCTGCGCCTGAGTCTGGGCTTGTA
TCACGGGGAGCAGATTCGCCTGCCGTTGCTGGAGGCGATTCGCGGTTACGTGCCGCCTCCGCCTCCGCCC
AGGCCGGTGCAGCGCGTCGCGCCGGATGTCATCCGCCTTGACAGCATGTCGCTATTCGATACCGGGAAAT
GGGTACTGAAGCCTGGTTCGACAAAGCGGCTGGTCAGCTCGCTGATGGACATTAAGGCCAGGCCCGGGTG
GCTGATCGTGGTGGCGGGTCACACCGACAGCGTGGGTGAGGAAAAAGCCAACCAGCTATTGTCGCTGAAA
CGTGCGGAATCGGTCCGCGACTGGATGCGCGATACCGGCGACGTGCCGGACAGCTGCTTTGCCGTTCAGG
GCTATGGCGAAAGCCGACCAATTGCAACAAACGATACGCCGGAAGGCCGTGCGCTGAACCGTCGTGTCGA
AATCAGTCTGGTGCCGCAGGTAGACGCCTGCCGGTTACCGGACCAACCCTCTGCGTCATCCCAGGATGAT
GGCGCTTCACTACACAATGGAGAGTAA