SecReT6
Protein ID: 378978463
SecReT6 ID548
T6SS typei2
Gene symbol-
Locus tagKPHS_23040
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]2335474..2337843 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG8VZI2
KEGG IDkpm:KPHS_23040
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.20E-67, Aligned region: 31..352
DUF2345 [PF10106], Evalue: 2.20E-42, Aligned region: 549..563
DUF2345 [PF10106], Evalue: 2.20E-42, Aligned region: 610..756
T6SS_Vgr [PF13296], Evalue: 4.40E-34, Aligned region: 486..588
T6SS_Vgr [PF13296], Evalue: 4.40E-34, Aligned region: 625..674
Phage_base_V [PF04717], Evalue: 1.50E-16, Aligned region: 386..479
Protein Sequence: 789 a.a.     [Download]
>gi|378978463|ref|YP_005226604.1| Rhs element Vgr protein [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MKSLLFSHNHHLLSVQGCEAGLDVLAFEGDEALSQPFRYRIEFTSADHAISKEMMLMKAASLTLQAPVAQ
GFGINVQQPVRVIQGVVTGFERLGTSRDETHYALTLQPRLALLNRSHQNAIYQDQSVPQIVEKILRERHG
LRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADTRLHIDVAEFCDSQQGYEKGLTL
PSVPPSGQQSAGVDAVWEMACRHRVVEQQVSTRDYNYREATADMNAQVDVTRGETTTFGEAYHWGDNYLT
AGNVHDRHPAPESGAFYARLRHERYLNGQTRMQATTSCPTLCPGQVLKVTGGEEVAREFADGVLITAMHS
HARRDADFAVEFAGIPDSPDVGYRPEPGARPVMAGTLPARVTSTRENDTYGHIDKHGRYRVNMLFDRARW
ETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVTIRNDKRNVLR
TPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDSDRQPRGEGFELRTDSWGAIRAQKGIFISADGQ
VQAQGQVLAMEPAVSLLKGAVNQVTEWGSITQTHHNVIPDTGPLSALTTGASDLKQPTLLMSAPQGIAAV
TPETTLLHSGKGLYLQSLGEVNITTAQRCSLNASQAISLLAQQEGMRLVSAKGPLQVESHGDILSLTALK
DITVQSTQGHLQLTAKNGITLGCGGAYIRLTPQGEIQIHGPGVISLKGQHDLQGPVSEEFPLPELPASVC
KECLKKAQALAQGFVPREA
 
Nucleotide Sequence: 2370 bp     [Download]
>gi|378976159|ref|NC_016845.1|:2335474-2337843 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
GTGAAATCGTTGTTGTTCAGCCATAACCACCACCTGCTTTCGGTGCAGGGATGTGAAGCCGGGCTTGATG
TGCTGGCCTTCGAGGGCGATGAAGCCCTGAGCCAGCCGTTCCGCTACCGTATTGAATTCACCAGCGCAGA
CCATGCCATCAGCAAAGAGATGATGCTGATGAAGGCAGCCTCCCTGACGCTGCAGGCGCCGGTGGCTCAG
GGCTTCGGCATCAATGTTCAGCAACCCGTGCGGGTGATCCAGGGCGTGGTGACGGGGTTTGAAAGGCTCG
GTACCTCCAGGGATGAAACGCACTACGCGCTGACGCTTCAGCCGCGCCTGGCGCTGCTCAACCGCTCGCA
CCAGAACGCCATTTACCAGGACCAGTCCGTTCCGCAGATTGTGGAAAAAATCCTCCGCGAGCGCCACGGC
CTGCGCGGTCAGGATTTTCTGTTCTCGCTGACAAAAACGTATCCGCGACGCGAGCAGGTGATGCAGTACG
GCGAGGATGACCTGCGCTTTATCACCCGGCTGCTGGGAGAGGTGGGGATCTGGTTTCGCTTTACCGCCGA
CACGCGGCTGCACATCGACGTCGCTGAGTTCTGCGACAGTCAGCAGGGCTATGAGAAGGGGCTGACGTTG
CCTTCGGTCCCGCCGTCAGGGCAGCAGTCGGCCGGGGTGGACGCGGTGTGGGAGATGGCATGCCGCCACC
GCGTCGTGGAGCAGCAGGTCAGTACCCGCGACTACAACTACCGCGAGGCGACGGCGGACATGAACGCGCA
GGTGGATGTCACCCGCGGGGAGACCACCACCTTTGGTGAGGCTTACCACTGGGGAGATAACTACCTGACC
GCCGGGAATGTCCATGACCGCCATCCGGCGCCGGAGTCCGGGGCGTTTTACGCCCGTCTTCGTCATGAGC
GTTATCTGAACGGCCAGACCCGGATGCAGGCCACCACCAGCTGCCCGACGCTCTGCCCGGGACAGGTGCT
GAAGGTCACCGGCGGAGAGGAGGTGGCCAGGGAGTTTGCTGATGGCGTGCTCATCACGGCGATGCACAGC
CACGCCCGGCGCGATGCCGACTTTGCGGTGGAGTTTGCCGGCATACCGGACAGCCCGGACGTCGGCTACC
GGCCTGAGCCCGGCGCGCGTCCGGTGATGGCCGGGACGCTGCCGGCCCGCGTGACCAGCACCCGGGAAAA
CGACACCTACGGGCATATCGACAAACACGGACGCTACCGGGTGAATATGTTGTTTGATCGGGCGCGCTGG
GAAACCGGGTTCGAGAGCCTGTGGGTCCGTCAGTCGCGGCCGTATGCCGGAGACACCTACGGCCTGCACC
TGCCGCTGCTGGCCGGGACGGAGGTGGCGATTGGCTTTGAGGATGGTAACCCTGACCGGCCGTATATCGC
GGGCGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATCCGCAATGACAAACGTAACGTCCTGCGC
ACCCCGGCCAACAACAAAATCCGCCTCGACGATGAGCGCGGGAAAGAACATATCAAGGTCAGCACGGAGT
ACGGCGGTAAAAGCCAGCTGAACCTGGGGCACCTGGTGGACAGTGACAGGCAGCCGCGCGGCGAAGGCTT
TGAGCTGAGAACCGACAGCTGGGGAGCTATCCGGGCACAGAAAGGGATATTTATCAGCGCGGACGGACAG
GTGCAGGCTCAGGGGCAGGTGCTGGCGATGGAGCCGGCGGTCAGTTTGCTGAAAGGTGCGGTGAATCAGG
TCACGGAATGGGGAAGCATTACGCAAACCCATCATAATGTTATCCCAGACACCGGCCCATTAAGCGCACT
GACCACAGGCGCCAGCGATCTTAAACAGCCGACATTGCTGATGTCGGCCCCGCAGGGGATTGCCGCAGTC
ACGCCGGAAACAACCCTCCTGCACAGCGGTAAGGGGCTGTATCTGCAGAGCCTGGGAGAGGTCAACATCA
CCACGGCACAGCGCTGTTCTCTGAATGCCAGCCAGGCTATTTCACTGCTGGCGCAACAGGAGGGGATGAG
GCTGGTCTCCGCCAAAGGTCCGCTGCAAGTAGAGTCGCACGGCGATATTCTATCGCTGACCGCGCTAAAA
GATATCACCGTCCAGTCAACCCAGGGGCATCTGCAGTTGACGGCTAAAAATGGCATCACCCTGGGTTGCG
GCGGCGCATATATCCGTCTTACCCCGCAGGGAGAGATACAGATCCACGGACCGGGGGTGATTAGCCTTAA
GGGGCAGCATGATTTGCAGGGGCCGGTCAGCGAGGAGTTTCCCTTGCCTGAGCTACCGGCATCGGTGTGT
AAAGAGTGCCTTAAAAAAGCCCAGGCGCTGGCGCAGGGCTTCGTGCCGCGGGAGGCATAG