SecReT6
Protein ID: 378978471
SecReT6 ID548
T6SS typei2
Gene symbol-
Locus tagKPHS_23120
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]2343463..2343720 [+]
ProductPaaR repeat-containing protein
NotePAAR
UniProt IDG8VZJ0
KEGG IDkpm:KPHS_23120
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 7.40E-17, Aligned region: 6..77
Protein Sequence: 85 a.a.     [Download]
>gi|378978471|ref|YP_005226612.1| PaaR repeat-containing protein [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MNKVIRKGDTLREYGGRVLMGHYQCFGLGFACKGDPVKCNKHGMTTIAEGSARTTIDGQPVALHGHRCAC
GCTLVSSNPDCGVDQ
 
Nucleotide Sequence: 258 bp     [Download]
>gi|378976159|ref|NC_016845.1|:2343463-2343720 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAATAAAGTCATTCGCAAAGGCGATACCCTGCGGGAGTATGGGGGCAGGGTGCTGATGGGGCATTATC
AGTGTTTTGGTCTGGGGTTCGCCTGCAAGGGCGACCCGGTCAAGTGTAACAAACACGGTATGACGACCAT
TGCTGAAGGCAGCGCACGAACAACGATTGATGGCCAGCCGGTTGCGCTGCACGGTCATCGCTGCGCCTGC
GGCTGCACGCTGGTCAGCTCTAACCCAGACTGCGGGGTTGATCAGTGA