SecReT6
Protein ID: 378978474
SecReT6 ID548
T6SS typei2
Gene symbol-
Locus tagKPHS_23150
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]2348265..2348672 [+]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDG8VZJ3
KEGG IDkpm:KPHS_23150
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.00E-22, Aligned region: 66..127
Protein Sequence: 135 a.a.     [Download]
>gi|378978474|ref|YP_005226615.1| type VI secretion-associated protein [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MSILQNLVAASQLDESALRQQARSRQAQWQSWLAPVSDAQPTGDDPGYDDDFQRIREEVNKISGVDTELI
CQLAEKLLTQTCKDLRVITFYVWARLQRDGETGLAEGVTLLAAMLERFGAMLHPQRERSCKSALE
 
Nucleotide Sequence: 408 bp     [Download]
>gi|378976159|ref|NC_016845.1|:2348265-2348672 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAGCATTTTACAAAATTTGGTTGCCGCCAGTCAGTTGGATGAAAGCGCACTGCGCCAGCAGGCCCGGT
CACGCCAGGCGCAGTGGCAGTCCTGGCTTGCGCCAGTCAGTGACGCCCAACCAACCGGGGACGATCCGGG
CTATGACGATGATTTTCAGCGTATCCGCGAGGAGGTCAATAAGATCTCCGGCGTCGATACCGAACTGATT
TGCCAGCTGGCAGAAAAACTGCTGACTCAGACCTGCAAGGATCTGCGCGTGATCACCTTTTACGTGTGGG
CGCGTCTGCAGCGGGATGGTGAAACCGGTCTGGCGGAGGGCGTTACGCTGCTGGCGGCAATGCTTGAGCG
GTTTGGGGCTATGCTCCATCCCCAGCGTGAACGTAGCTGTAAATCAGCGCTGGAATAG