SecReT6
Protein ID: 378978476
SecReT6 ID548
T6SS typei2
Gene symbol-
Locus tagKPHS_23170
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]2349937..2351691 [+]
Producthypothetical protein
NoteTssF
UniProt IDG8VZJ5
KEGG IDkpm:KPHS_23170
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-180, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|378978476|ref|YP_005226617.1| hypothetical protein KPHS_23170 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPFVERLFEGFAFLMGRMREKLDDDLPE
LTEGVVSLLWPHYLRTIPSMSVVEFTPDWPEMKEPMTMAKGFEVLSRPIGEKGTRCRYTTTKAIALQPLS
LERVQLATDTDGRSVITLRFTCSQLTDWRRVDLSHIPLYCNADAPLACAMHEAFTLNVARMWLRMPEEVD
RRPLDGYFSALGFGEDDGLWPEDGRSFRGYQLLLEYFTFREKFMFIDLRGLETVAFPAGLAWFEIDVVLA
ERWEHDFRFSEKQLRLHCVPVINLFPLESDPLTINSLQTEYPLRPMRVQDGHTEIYTVDSVISSHQQVYA
PFSSFRHKGGMMRHDAADYYYHTRVRRGPSGLYNTWLIVGGEAFDNHTVPEDESLSLTLTGTNGQLPRRA
LQSTVLDTVMKTTSASIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSSFLSLMDNAEVLRGTLALYEWTD
SEMNRRRLEAILDVKHRATERFAQGHLVRGVQIEVTLDSHGFAGRGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHSRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|378976159|ref|NC_016845.1|:2349937-2351691 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGGACGATTTAACCCTGCGTTATTACGACGCTGAAATGCGCTACCTGCTGGAAGCGGGTGAAGAGTTTG
CCCGCGCTCATCCTGAGCAGGCGGCAATGCTCAATCTCGACAAAGCGGGCGCTCGCGACCCCTTTGTCGA
GCGTCTGTTTGAAGGTTTTGCCTTCCTGATGGGCCGCATGCGCGAGAAACTCGATGACGATCTGCCTGAG
CTGACCGAAGGCGTGGTCAGTCTGCTGTGGCCACATTATTTACGTACCATTCCCTCGATGTCGGTCGTGG
AGTTCACCCCCGACTGGCCGGAAATGAAAGAGCCGATGACGATGGCCAAAGGCTTTGAAGTGCTTTCCCG
GCCGATCGGTGAAAAGGGCACGCGCTGCCGGTACACCACCACCAAAGCGATCGCTCTGCAGCCGTTATCC
CTGGAACGCGTCCAGCTGGCCACCGATACGGATGGCCGGTCGGTGATCACGCTGCGCTTTACCTGCAGCC
AGCTGACGGACTGGCGCCGGGTCGATCTCAGTCATATCCCGCTGTACTGCAACGCCGATGCGCCGCTGGC
CTGCGCCATGCACGAGGCCTTTACCCTCAATGTGGCCCGGATGTGGCTGCGCATGCCCGAAGAGGTGGAC
AGAAGGCCGCTGGACGGGTATTTCAGCGCGCTGGGATTTGGCGAGGATGACGGCCTCTGGCCTGAAGATG
GCCGCAGTTTTCGCGGTTATCAGCTGCTGCTGGAGTATTTTACCTTCCGCGAAAAGTTCATGTTCATCGA
TCTGCGCGGGCTGGAGACGGTGGCTTTTCCGGCCGGACTGGCGTGGTTTGAAATCGACGTCGTGCTGGCG
GAACGCTGGGAACATGACTTCCGCTTCAGCGAAAAGCAGCTGCGCCTGCACTGCGTGCCAGTGATCAACC
TGTTTCCGCTGGAGTCCGATCCGCTGACCATCAATTCCCTGCAGACCGAATACCCGCTGCGCCCGATGCG
CGTGCAGGACGGCCACACCGAAATTTACACCGTCGATTCCGTGATCTCCTCACACCAGCAGGTTTACGCG
CCGTTCTCAAGTTTTCGCCACAAAGGCGGCATGATGCGTCATGACGCGGCGGACTATTACTATCATACCC
GGGTGCGCCGTGGCCCCTCCGGGCTGTACAACACCTGGCTTATCGTCGGCGGAGAAGCCTTTGATAATCA
TACCGTACCGGAAGATGAAAGCCTGTCGCTGACCCTCACCGGAACCAACGGCCAGCTGCCGCGTCGCGCG
CTGCAGAGCACCGTGCTCGATACGGTGATGAAAACCACTTCCGCCAGTATTGCAGTGCGTAACCTCTGCG
CGCCGACGCTGCCGTGCTATCCCCCCGCCCAGGACCGTTTTCACTGGCGGGTGCTGAGCCATCTGGGCAG
CAGTTTTCTTTCCCTGATGGATAACGCGGAGGTCCTGCGCGGCACCCTGGCGCTGTATGAATGGACCGAC
AGCGAGATGAATCGTCGGCGTCTGGAAGCCATCCTCGACGTGAAGCACCGCGCAACAGAGCGCTTTGCAC
AGGGCCATCTGGTGCGCGGCGTGCAGATTGAAGTCACCCTCGACAGTCACGGCTTTGCCGGACGTGGCGA
TATATGCCTGTTTGGCGAGATGCTTAGCCGCTTCTTCGCGCTCTACACCGACATCTACTTGTTCAACCGC
CTGATTATCATTCTGCAACCAACCGGAGAACGACTGGAATGGGAAGAGAAGCACAGCCGCCGCATTCCCG
GCTGA