SecReT6
Protein ID: 378978477
SecReT6 ID548
T6SS typei2
Gene symbol-
Locus tagKPHS_23180
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]2351655..2352740 [+]
Producthypothetical protein
NoteTssG
UniProt IDG8VZJ6
KEGG IDkpm:KPHS_23180
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.90E-73, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|378978477|ref|YP_005226618.1| hypothetical protein KPHS_23180 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MGREAQPPHSRLTPRLEADLPRINFYRFCQLLEKRRPGQPLMGGTSHPADDPVRFYPHPGMGFPASELKA
VEYDEADDSRPPVIRTTFMGLYGVDSPLPTAYLDDIAQHREGHEALQGLLDIFSHRIMTQFYRIWRKYSW
PATFEPGGTDRLSQSLLGLAGLGIPGTTQHIASPASRFLALTGVLRQPGKTQQGIQALVTLLAPETTVRV
SPYSLRPVAISQPLGFYGDDDFFLDGNTPLGDEAMDASSQLLVALTTDNPAEAQGWKPDGPLFRDFLILL
RVYLGWRFRANITLTAPTRLLAVPPLGDEPFWLGMNGVLGVGDGESEGDIPQTFTTELGTYTGLQPATFL
QGNRRVTYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|378976159|ref|NC_016845.1|:2351655-2352740 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGGGAAGAGAAGCACAGCCGCCGCATTCCCGGCTGACCCCGCGACTGGAGGCCGACCTGCCGCGGATCA
ATTTTTACCGCTTCTGCCAGCTTCTGGAAAAACGGCGTCCCGGCCAACCACTGATGGGGGGAACCAGCCA
TCCGGCTGACGATCCGGTGCGTTTTTACCCGCATCCGGGAATGGGATTTCCCGCCAGCGAACTGAAAGCC
GTGGAATACGATGAGGCCGATGACAGCAGGCCGCCGGTCATTCGCACCACCTTTATGGGGTTGTACGGTG
TCGATTCGCCGCTCCCGACGGCATATCTCGATGATATCGCCCAGCACAGGGAAGGGCATGAAGCGCTGCA
GGGCTTACTGGATATCTTCAGCCACCGGATCATGACGCAGTTTTACCGCATCTGGCGGAAATACTCCTGG
CCCGCCACCTTTGAGCCCGGCGGCACCGATCGTCTCTCGCAGTCGCTACTGGGCCTGGCGGGGCTAGGCA
TCCCCGGCACGACGCAGCATATCGCCTCGCCGGCGTCGCGCTTTCTGGCGCTAACCGGCGTGCTGCGTCA
GCCGGGCAAAACCCAGCAGGGGATCCAGGCGCTGGTCACCCTGCTGGCCCCGGAGACCACCGTCAGGGTG
AGCCCGTACAGCCTGCGTCCGGTGGCGATCAGCCAGCCGCTGGGGTTTTACGGCGATGACGACTTCTTCC
TGGACGGCAATACGCCGCTGGGTGACGAAGCGATGGATGCCAGCAGCCAGCTCCTCGTCGCCCTTACCAC
CGACAATCCCGCGGAGGCGCAGGGCTGGAAGCCTGACGGCCCGCTGTTTCGGGACTTTCTCATCCTGCTG
CGGGTATACCTCGGCTGGCGATTCCGGGCCAACATCACCCTGACCGCGCCGACCCGACTGCTGGCTGTCC
CGCCGCTGGGGGACGAGCCGTTCTGGCTCGGTATGAACGGCGTGCTGGGCGTGGGTGATGGCGAGAGTGA
GGGCGATATTCCTCAGACCTTTACCACCGAGCTGGGTACCTATACGGGCCTGCAGCCTGCCACCTTTCTA
CAAGGAAACCGACGTGTTACGTATAAGTTTGACTAA