SecReT6
Protein ID: 378978478
SecReT6 ID548
T6SS typei2
Gene symbol-
Locus tagKPHS_23190
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]2352718..2353260 [+]
Producthypothetical protein
NoteTssJ
UniProt IDG8VZJ7
KEGG IDkpm:KPHS_23190
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-35, Aligned region: 17..171
Protein Sequence: 180 a.a.     [Download]
>gi|378978478|ref|YP_005226619.1| hypothetical protein KPHS_23190 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MLRISLTKTACLLPLLALCLSGCGLTQRVSEGTKSAFNAVFYKKINTLHLDFTAREALNTDARENHSLSE
PVVVRIYQLKDRQTFDRLVYQQLLEEGDILLAADLLASRDVVIGPGGDASLNMPLEAEATFVAVVGLFRH
PDTQRNTWKQVLAREELDPDKPRIFTAEHNQLRLRPEAAK
 
Nucleotide Sequence: 543 bp     [Download]
>gi|378976159|ref|NC_016845.1|:2352718-2353260 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
GTGTTACGTATAAGTTTGACTAAAACCGCCTGTCTGCTGCCCCTGCTTGCGCTTTGCCTGAGCGGATGCG
GACTCACCCAGCGCGTCTCGGAGGGAACAAAGTCTGCCTTCAACGCCGTTTTTTATAAGAAAATTAATAC
GCTGCATCTGGACTTTACCGCGCGCGAAGCGCTCAACACCGATGCCAGAGAGAATCACTCGCTCTCTGAA
CCGGTGGTGGTGCGCATCTATCAGCTTAAAGATCGCCAGACCTTTGACCGGCTGGTTTACCAGCAGCTGC
TGGAGGAGGGGGATATTCTGCTCGCCGCCGATCTCCTCGCCAGTCGCGATGTGGTGATCGGTCCCGGAGG
GGACGCCAGTCTGAATATGCCGCTGGAAGCGGAGGCGACGTTCGTGGCGGTTGTCGGCCTGTTCCGCCAT
CCGGACACACAAAGAAATACCTGGAAGCAGGTGCTGGCGCGTGAGGAATTGGATCCGGACAAGCCGCGCA
TTTTCACCGCCGAACACAACCAGCTACGGCTCAGGCCTGAAGCGGCGAAGTAA