SecReT6
Protein ID: 378979404
SecReT6 ID549
T6SS typeN/A
Gene symbol-
Locus tagKPHS_32450
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]3235063..3236478 [-]
Producthypothetical protein
NoteTssA
UniProt IDG8VW36
KEGG IDkpm:KPHS_32450
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.00E-51, Aligned region: 36..61
DUF3702 [PF12486], Evalue: 3.00E-51, Aligned region: 90..178
DUF3702 [PF12486], Evalue: 3.00E-51, Aligned region: 303..447
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 324..340
ImpA-rel_N [PF06812], Evalue: 1.30E-17, Aligned region: 356..374
Protein Sequence: 471 a.a.     [Download]
>gi|378979404|ref|YP_005227545.1| hypothetical protein KPHS_32450 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MMTTHHDRHYKAGGDPRTLADFMALRAEMNKLSHPARPDINWPYAEQLARGLLEHHGADLQTVAWYTLAR
ARLGGVAGINEGLTLMESLLVRQGKNLWPQALPARTEIFRTLSKRLRQVIRTLNLTPEDVESLEQAERSL
QSFDAVLQRLEIAPENQLSDLRALLHSTATRFESLDPAPALPTAPPVAVSDAELPGTLVSEEDAAKVEPV
PDLKRRPKAEPLAPPSPAKRPAPVAASTPAAAPRWKPFIAGMVTMLAVTGIAVGGWLALRQSDLPPISVT
QNAGPIPGLPATTPPGPVDLPQTQRQLGELARLAPDWAVSYGDQLVHQALIRWPDQAQPLAQQWRQQLSA
GALPAENLTGWSEGMQQLQRLADQLNALDEQKGKYLTVSELKTAVFAITQSFNRAVPLEEQLRQLAALPV
DQPWPAARGSLAELHLQQLIVEYALLKRKQPASPTAALPATGEPSVSEAVK
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c3236478-3235063 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGATGACAACACACCACGACCGTCACTATAAAGCCGGTGGCGACCCGCGCACGCTGGCTGATTTTATGG
CCCTGCGTGCGGAAATGAACAAGCTCAGCCACCCGGCGCGGCCGGATATTAACTGGCCGTATGCCGAGCA
GCTTGCCCGCGGGCTGTTGGAGCATCACGGCGCGGACCTGCAGACTGTCGCCTGGTATACCCTGGCCCGC
GCCCGGCTGGGCGGGGTGGCAGGGATCAATGAGGGGCTGACGCTGATGGAGTCGCTGCTGGTTCGTCAGG
GGAAAAACCTGTGGCCACAGGCGCTCCCGGCCCGGACAGAGATCTTCCGCACCCTGAGCAAGCGGCTGCG
GCAGGTGATCCGTACCCTGAATCTTACCCCAGAGGATGTTGAGTCGCTTGAGCAGGCTGAACGTTCGCTG
CAAAGCTTCGACGCAGTGCTCCAGCGCCTTGAGATCGCTCCTGAAAACCAGCTGAGCGACCTGCGGGCGC
TACTGCACAGCACGGCAACTCGCTTCGAGAGCCTCGACCCTGCGCCAGCGCTTCCCACCGCGCCGCCGGT
GGCGGTGTCTGACGCGGAACTTCCCGGCACTCTGGTCAGCGAAGAGGATGCGGCGAAGGTTGAGCCAGTG
CCAGACCTAAAACGTAGACCAAAGGCTGAGCCGCTGGCTCCGCCTTCACCTGCAAAGCGGCCCGCGCCGG
TGGCGGCGTCTACTCCGGCAGCCGCGCCGCGCTGGAAGCCGTTTATCGCCGGGATGGTTACCATGCTGGC
GGTAACGGGTATCGCCGTCGGCGGATGGCTGGCGCTGCGTCAGTCCGACTTGCCGCCCATTTCAGTCACC
CAAAATGCCGGACCGATACCGGGCCTGCCGGCGACAACGCCCCCGGGGCCGGTTGATCTGCCACAGACGC
AGCGCCAGCTTGGCGAGCTTGCCCGCCTGGCGCCGGACTGGGCGGTCAGCTACGGCGACCAGCTGGTCCA
CCAGGCCCTGATCCGCTGGCCGGATCAGGCGCAACCGCTGGCGCAGCAGTGGCGGCAGCAGCTGAGTGCT
GGCGCATTGCCCGCGGAAAACCTTACCGGCTGGTCGGAGGGCATGCAGCAGCTGCAGCGGCTCGCCGACC
AGCTCAATGCCCTCGACGAGCAGAAGGGGAAGTACCTGACGGTGAGCGAACTGAAAACCGCAGTATTTGC
CATCACACAGTCGTTTAACCGCGCTGTTCCGCTGGAGGAGCAGCTGCGCCAGCTGGCCGCGCTTCCCGTT
GATCAACCCTGGCCAGCCGCGCGGGGAAGCCTCGCGGAGCTGCATCTGCAACAGCTGATAGTGGAGTATG
CCCTGCTGAAGCGAAAACAGCCGGCGTCGCCGACCGCTGCGCTCCCCGCAACCGGTGAGCCCTCGGTGAG
TGAGGCGGTGAAATAA