SecReT6
Protein ID: 378979405
SecReT6 ID549
T6SS typeN/A
Gene symbol-
Locus tagKPHS_32460
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]3236498..3236941 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDG8VW37
KEGG IDkpm:KPHS_32460
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.10E-16, Aligned region: 26..113
Protein Sequence: 147 a.a.     [Download]
>gi|378979405|ref|YP_005227546.1| type VI secretion system lysozyme-like protein [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MPRPSLYDILYGNFAGGLDLNTVSETDQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTAILQGMPASA
HQLMSTLSAVLLKYEPRLQRIAVVMLDQHAPGELRYAIDAELKDIGLVRYGTEFMPEGRVLIRHLKRQQY
LDARSAL
 
Nucleotide Sequence: 444 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c3236941-3236498 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGCCTCGTCCCTCCCTGTATGACATCCTGTACGGCAATTTCGCCGGCGGGCTTGACCTGAATACCGTCA
GCGAAACGGATCAGGTCATCCTGTCGGTGCTCGATAACATGCAGCGCATCCTCAACTGTCGGGCCGGAAC
GCTGGCGCATCTGCCGGACTACGGCCTGCCGGATATGACCGCTATCCTCCAGGGGATGCCAGCGTCGGCG
CACCAGCTGATGAGCACGTTGTCTGCGGTGTTGCTGAAATACGAACCGCGTCTGCAGCGGATCGCGGTGG
TGATGCTCGATCAGCATGCGCCCGGCGAACTGCGCTATGCCATTGATGCGGAGCTGAAGGATATTGGCCT
GGTGCGTTACGGCACGGAGTTTATGCCCGAGGGCAGGGTGTTGATCCGCCACCTCAAACGTCAGCAGTAC
CTTGACGCCCGCTCCGCCCTCTAA