SecReT6
Protein ID: 378979406
SecReT6 ID549
T6SS typeN/A
Gene symbol-
Locus tagKPHS_32470
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]3236944..3237432 [-]
Producthypothetical protein
NoteTssJ
UniProt IDG8VW38
KEGG IDkpm:KPHS_32470
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-38, Aligned region: 3..153
Protein Sequence: 162 a.a.     [Download]
>gi|378979406|ref|YP_005227547.1| hypothetical protein KPHS_32470 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MVTVLTGCGLTQTVKDGAVSVTQSIFYPQVKTLHLDLRAREGVNNNAKGASLATVVRIYQLKDRQAFDNT
DYPSLFAGDGQALQADRVAEKDVRLRPGESVTVDMPMETSAQFVAVAAMFIDPDLTQNSWRLVLTRDELD
PARPRIIEASQNQLTLHPFKEK
 
Nucleotide Sequence: 489 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c3237432-3236944 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGGTTACCGTCTTAACCGGCTGCGGACTGACGCAGACCGTGAAAGACGGCGCCGTTTCCGTGACCCAGT
CCATTTTTTACCCCCAGGTGAAAACCCTGCATCTGGATCTTCGCGCCCGGGAAGGCGTGAATAACAACGC
CAAAGGCGCCTCCCTGGCGACGGTGGTGCGTATTTATCAGCTGAAGGACCGGCAAGCGTTCGACAATACT
GACTACCCGTCGCTGTTTGCCGGCGATGGCCAGGCGCTGCAGGCGGACCGGGTGGCGGAAAAAGATGTTC
GCCTGCGTCCGGGCGAATCGGTGACCGTCGATATGCCCATGGAAACCAGCGCGCAGTTTGTGGCGGTGGC
GGCCATGTTTATCGATCCAGACCTGACGCAAAACAGCTGGCGGCTGGTACTCACCCGGGACGAACTTGAT
CCGGCGAGGCCGCGCATTATCGAAGCCAGCCAAAATCAACTGACGCTGCACCCGTTTAAGGAGAAGTGA