SecReT6
Protein ID: 378979407
SecReT6 ID549
T6SS typeN/A
Gene symbol-
Locus tagKPHS_32480
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]3237461..3238477 [-]
Producthypothetical protein
NoteTssG
UniProt IDG8VW39
KEGG IDkpm:KPHS_32480
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.90E-82, Aligned region: 1..299
Protein Sequence: 338 a.a.     [Download]
>gi|378979407|ref|YP_005227548.1| hypothetical protein KPHS_32480 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MNFYRFCQLLEKNHPKAPIIGSGWLVGDEPIRFRPHPGMGFPAGEIRAMDDPEPPRPPAVRVTFMGLYGV
ESPLPTHYSDDIAQRREGVEATEDFLDIFNHRLIAQYYRIWRKYSYPATFRAGGTDNISQYLLGLAGLGI
PGCAAVAAAPLSRFLALLPVMMLPGRSGEGMEALVALLAPGTRATVYHHDPCRIPLSQPLTMSVRQPVSL
QHRPVMGTHATDVNGQVLLQLATEKPDEVRGWLPGGELFSDLMALLHVWLGSHLDVRLQLCVARHLLPDA
QLCCQQEHAVQLGRTAVLRPLDAQKQADDRVTIYLGRYQRVRENIHRRESDEDGDYRS
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c3238477-3237461 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAATTTTTACCGCTTCTGCCAGTTGCTGGAGAAGAACCATCCGAAGGCGCCGATCATCGGCAGCGGCT
GGCTAGTAGGTGATGAACCCATACGCTTTCGCCCGCATCCGGGGATGGGCTTTCCGGCTGGCGAAATCCG
TGCAATGGACGATCCTGAACCGCCCCGTCCGCCGGCGGTTCGCGTGACTTTTATGGGACTCTACGGCGTG
GAATCCCCGCTGCCGACCCACTATAGCGATGACATTGCGCAACGGCGGGAAGGCGTCGAGGCCACCGAGG
ATTTCCTCGATATCTTTAACCATCGGCTGATCGCCCAGTATTACCGTATCTGGCGCAAATATTCCTACCC
GGCAACCTTTCGGGCGGGCGGCACGGACAACATCTCGCAGTATCTGCTGGGCCTGGCGGGGCTGGGCATA
CCGGGATGTGCCGCCGTTGCCGCAGCGCCGCTGTCGCGATTTCTGGCGCTGCTGCCGGTGATGATGCTGC
CGGGGAGATCCGGGGAAGGCATGGAGGCGCTGGTGGCGCTCCTGGCCCCGGGGACCCGGGCGACGGTGTA
CCACCACGATCCCTGCCGGATCCCCTTGTCGCAGCCGTTAACGATGAGCGTCCGTCAGCCGGTTAGCCTG
CAACATAGGCCAGTGATGGGAACCCACGCCACGGATGTGAACGGTCAGGTATTGCTGCAGCTGGCCACGG
AAAAGCCTGATGAGGTTCGCGGCTGGCTGCCCGGCGGCGAACTGTTCAGCGACCTGATGGCGCTTCTGCA
CGTCTGGCTCGGATCTCATCTTGACGTGCGGCTGCAGCTTTGCGTCGCCCGCCATTTACTGCCGGATGCG
CAACTTTGCTGCCAGCAGGAGCATGCCGTCCAGCTCGGCCGTACCGCTGTGCTGCGTCCGCTGGATGCGC
AGAAACAGGCTGACGACAGAGTCACGATTTATCTGGGGCGCTATCAGCGCGTCCGGGAAAATATCCACCG
CAGGGAGAGCGATGAAGATGGCGATTACCGCAGTTAA