SecReT6
Protein ID: 378979408
SecReT6 ID549
T6SS typeN/A
Gene symbol-
Locus tagKPHS_32490
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]3238507..3240270 [-]
Producthypothetical protein
NoteTssF
UniProt IDG8VW40
KEGG IDkpm:KPHS_32490
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-183, Aligned region: 6..582
Protein Sequence: 587 a.a.     [Download]
>gi|378979408|ref|YP_005227549.1| hypothetical protein KPHS_32490 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MDDLTLRYFDAEMRYLREAAKAFAQAHPDRAAMLDLDKAGTPDPYVERLFEGFAFSVGRLREKIDDDLPE
LTEGLVSMLWPHYLRTIPSLSIVALTPTLPAMKIAETVPAGFEISSRPLGPKNTVCRYRTTRDLTLNPLA
IEEAVMTAEPDGRSALRLRFACSELADWSQTDLRHLALYLGEDAVTGSALHLWLTRRQAALYLRLPGQTE
RVSLDGYFSPGGFSEEDRLWPKGESAFSGYQLLLEYFTFREKFMFVQLNGLENITLPAGISHFTLEVVFS
EVWQSDLPVSASSLRLHCVPVINLFTLEADPLTISGLENEYLLRPKRLQDGHTEIYSVDSVTGSGRTGEA
RYVPFTRFRHQGGMMRRHAPERYYHTRVKRGVTGMHDTWLILGGQQWEADRELARETVSLRITGTNGQLP
RRALQSTLLDRCESISATPLTVRNLCKPTLPAYPPAEDRYHWRVMSHLGTRFLNMMSSAEVLRGTLSLYN
WREDELNNRRLDAILAVSHHRIQRFEQGFLLRGLDIEVTLDGSGFTGAGDVHLFGDMLNRFFALYADMNQ
FNQLTLIVQPEGKCIRWKENHSLRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c3240270-3238507 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGGACGATTTAACCCTGCGATATTTTGATGCTGAAATGCGCTACCTGCGCGAGGCGGCAAAAGCGTTCG
CGCAGGCTCACCCCGATCGGGCGGCGATGCTGGATCTCGATAAAGCCGGTACGCCGGACCCTTATGTAGA
GCGCCTGTTTGAAGGCTTTGCCTTTTCCGTAGGTCGCTTGCGCGAAAAAATTGATGATGATCTGCCGGAG
CTGACCGAGGGGCTGGTCAGCATGCTGTGGCCGCACTATTTGCGCACTATTCCATCGCTATCGATCGTGG
CGCTGACCCCAACGCTGCCGGCGATGAAGATAGCGGAAACGGTGCCCGCCGGGTTTGAGATTAGCTCCCG
CCCACTGGGGCCGAAAAATACCGTGTGCCGGTACCGAACCACCCGCGATCTGACGCTTAACCCGCTGGCG
ATAGAGGAGGCGGTGATGACGGCGGAGCCGGACGGACGTTCGGCCCTGCGACTACGATTCGCCTGTAGCG
AGCTGGCTGACTGGTCGCAGACCGATCTCCGCCACCTGGCGCTGTACCTGGGGGAAGACGCTGTTACCGG
CAGCGCCCTCCATCTGTGGCTGACCCGACGCCAGGCCGCGCTGTACCTGCGTCTGCCGGGTCAGACAGAG
CGGGTAAGCCTCGACGGCTATTTTTCCCCGGGGGGATTCAGCGAGGAGGATCGTTTATGGCCGAAGGGGG
AGAGTGCTTTCAGCGGCTATCAGCTGCTGCTCGAGTATTTCACCTTTCGCGAAAAATTTATGTTCGTGCA
GCTAAATGGCCTGGAAAACATCACCCTGCCGGCGGGGATATCGCATTTCACGCTTGAGGTGGTGTTCAGC
GAGGTCTGGCAAAGTGATTTACCCGTCAGCGCAAGCAGCCTACGCCTGCACTGTGTGCCGGTGATTAACC
TGTTTACCCTTGAGGCCGATCCGTTGACCATCAGCGGCCTGGAGAACGAATACCTCCTGCGTCCGAAGCG
CCTGCAGGACGGGCATACCGAAATCTATTCTGTTGACAGCGTGACCGGCTCCGGGCGCACCGGGGAGGCA
CGCTATGTGCCTTTCACCCGCTTTCGTCACCAGGGGGGAATGATGCGTCGCCATGCGCCGGAGCGCTACT
ACCACACCCGCGTAAAACGGGGCGTAACCGGCATGCACGATACCTGGCTTATCCTCGGCGGACAGCAATG
GGAGGCTGACCGGGAGCTGGCGCGGGAAACGGTCTCCTTGCGCATCACCGGCACTAACGGCCAGCTGCCG
CGCCGGGCGCTACAGAGCACGCTGCTGGATCGCTGTGAGTCGATATCAGCCACGCCGCTTACCGTCCGCA
ATCTCTGTAAGCCCACGCTGCCGGCCTATCCCCCGGCGGAAGACCGCTACCACTGGCGGGTCATGAGCCA
TCTGGGCACCCGTTTTCTCAACATGATGAGCAGCGCCGAGGTGCTGCGCGGCACGCTGTCGCTCTACAAC
TGGCGGGAGGATGAGCTCAATAATCGCCGTCTGGACGCCATTCTGGCGGTCAGCCATCACCGAATTCAGC
GTTTCGAGCAGGGTTTCCTGCTGCGCGGGCTGGATATTGAAGTGACGCTCGACGGTAGCGGATTTACCGG
TGCGGGCGATGTCCACCTGTTTGGCGATATGCTCAACCGCTTTTTCGCACTGTATGCCGATATGAATCAG
TTCAACCAGCTGACGCTCATTGTTCAACCTGAAGGGAAATGTATCCGGTGGAAAGAGAATCACAGTCTGC
GCCTGCCCGGCTGA