SecReT6
Protein ID: 378979411
SecReT6 ID549
T6SS typeN/A
Gene symbol-
Locus tagKPHS_32520
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]3244959..3245225 [-]
Producthypothetical protein
NotePAAR
UniProt IDG8VW43
KEGG IDkpm:KPHS_32520
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.60E-23, Aligned region: 9..81
Protein Sequence: 88 a.a.     [Download]
>gi|378979411|ref|YP_005227552.1| hypothetical protein KPHS_32520 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MSKGFVLLGDKTTHGGAVISASSTMIVNGKPVALVGDKVSCPIPGHGTNAIIEGAPEWSSDGKAIVVDGC
KCQCGCQVISGAPECAIG
 
Nucleotide Sequence: 267 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c3245225-3244959 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGTCCAAAGGTTTTGTATTACTCGGCGATAAAACCACGCACGGCGGTGCTGTTATTTCCGCATCCTCCA
CCATGATTGTAAATGGAAAGCCCGTAGCGCTGGTGGGGGATAAAGTCAGCTGCCCGATTCCGGGACATGG
CACTAATGCCATTATTGAGGGAGCGCCGGAATGGTCTTCCGATGGTAAAGCCATCGTGGTCGATGGCTGC
AAATGTCAGTGCGGTTGCCAGGTGATTTCCGGCGCGCCGGAATGCGCGATAGGATAA