SecReT6
Protein ID: 378979432
SecReT6 ID549
T6SS typeN/A
Gene symbol-
Locus tagKPHS_32730
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]3257035..3259521 [-]
Producthypothetical protein
NoteTssI
UniProt IDG8VWY9
KEGG IDkpm:KPHS_32730
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-64, Aligned region: 35..355
DUF2345 [PF10106], Evalue: 1.40E-54, Aligned region: 605..759
T6SS_Vgr [PF13296], Evalue: 4.20E-33, Aligned region: 487..593
Phage_base_V [PF04717], Evalue: 1.20E-15, Aligned region: 387..482
Protein Sequence: 828 a.a.     [Download]
>gi|378979432|ref|YP_005227573.1| hypothetical protein KPHS_32730 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MDTSSIITGTTLNRYQLDIPSCTASLDVEEFSGAEKLSELYYYTITFTSAEKNIDAAQLLSKPAMLTMGG
GALQQLADCKRVHGVVTAFRRISSSEDQSKYQITLEPFLSLLDKQFRSHRFFVNKSVPEVVEQVLQEHHL
HDWEYEFYLKQHYPRREQINQYQESDLAFIQRLLAEVGIFYFFTLQEEAQSEVVHFADAQRALTFDKTLP
VNSPSGMSDSGAESIWGLSITHNVVEANVTTRDYNPRDAQSVLQSATADMTRGNGEGITYGEVYHYKLRH
RERGDKIDPQTETANFYARLDHERFLAHQTLITAISTAAWLAPAQVLTVTDSLPSTLPAPVQDPLLITGT
GFTASRREALRVSLLAVPYSETLCWRPPLLPRPKVTGTMTARVTSAKANDIYAWQDASGLYRVKFDADRE
DKGQGQESMPVRLAKPYGGDVYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSRHVDPVTEKNSTRNV
IRTPANNKLRMEDKRGEEHIKLSTEYGGKTQLNLGHNVNAQRELRGEGAELRTDKWVSIRGGAGVFISAD
KQPSAGDRMLAMEEAIAQLENALGIAKSLASAAESAQALPSDTGNQQTLNDALKELAQPGIVLNAPQGVS
ISSPQAVRLSSGSASVGIVSQQNTDISALKRFTVAAGEAVSLLARKAGMKLFAAKGKMEIQAQDDALEAT
AKKDITVTSVEGRVEITAAKELVVNCAGAYIRLSGGNIELGCPGNILLKSANVQKMGKADFRVPPLELPK
GFEERFTVKDQKTGEIVPFARYRITTEKGQVFEGRADADGKTASVYTALPESIKIELL
 
Nucleotide Sequence: 2487 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c3259521-3257035 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGGATACCTCTTCAATAATTACCGGCACCACCCTTAACCGTTACCAGCTGGATATTCCTTCATGTACCG
CATCGCTGGATGTGGAAGAATTCAGTGGGGCAGAAAAACTGAGTGAACTTTATTATTACACTATTACGTT
TACCAGCGCAGAGAAAAATATTGATGCCGCACAGCTCCTGAGCAAACCCGCCATGCTGACGATGGGCGGC
GGCGCACTGCAGCAGTTGGCGGACTGCAAACGCGTCCATGGCGTGGTGACTGCCTTCCGGCGTATCAGCA
GTTCAGAAGATCAGTCGAAATATCAGATAACCCTCGAACCCTTCCTCTCCTTACTGGATAAACAGTTTCG
CAGCCACCGTTTTTTCGTGAATAAATCGGTGCCGGAGGTGGTGGAGCAGGTATTGCAGGAACATCACCTG
CATGACTGGGAGTATGAGTTTTATCTCAAGCAACACTATCCACGGCGCGAGCAAATTAATCAGTATCAGG
AGAGCGACCTGGCGTTTATCCAGCGCCTGCTGGCAGAGGTAGGGATATTTTATTTCTTCACCCTGCAGGA
AGAGGCGCAGAGCGAAGTGGTCCACTTCGCCGACGCGCAGCGGGCGCTGACGTTTGATAAGACACTCCCT
GTAAACAGCCCGTCGGGGATGAGCGACAGCGGTGCGGAATCGATATGGGGTCTGAGCATCACCCACAACG
TCGTAGAGGCGAACGTTACTACCCGGGATTATAACCCCCGCGATGCGCAGAGCGTTCTCCAGTCGGCAAC
AGCGGATATGACCCGGGGAAATGGTGAAGGCATCACTTACGGTGAGGTATACCACTATAAGCTTCGCCAC
CGGGAGCGTGGCGATAAAATCGACCCGCAGACGGAGACCGCCAACTTCTATGCCCGCCTCGACCATGAGC
GTTTTCTGGCTCACCAGACGCTTATTACCGCGATCAGTACTGCAGCCTGGCTGGCGCCGGCCCAGGTGCT
GACCGTTACCGACAGCCTGCCGTCGACCCTGCCTGCGCCCGTACAGGATCCGCTGTTAATCACCGGCACC
GGTTTTACCGCCAGCCGCCGGGAGGCGCTGCGGGTGTCCCTGCTGGCGGTGCCCTACAGCGAAACATTGT
GCTGGCGTCCGCCGCTGCTGCCGCGCCCGAAGGTGACTGGCACCATGACGGCGCGGGTGACCAGCGCGAA
GGCGAATGATATCTATGCCTGGCAAGATGCGTCCGGCCTGTACCGGGTGAAATTTGACGCTGACAGAGAG
GATAAAGGGCAGGGTCAGGAAAGCATGCCGGTGCGTCTCGCCAAACCCTACGGCGGCGACGTGTACGGCT
TTCACTTCCCGCTGATCCAGGGCACGGAGGTGGCGATTGCTTTCCACGAAGGCGATCCCGACCGGCCGTA
TATTGCGCATGCGCTGCATGACTCGCGGCATGTCGACCCTGTGACGGAGAAAAACAGCACCCGCAATGTG
ATTCGTACTCCGGCCAATAATAAGCTGCGAATGGAGGACAAGCGCGGCGAGGAGCATATCAAGCTCAGCA
CCGAGTACGGCGGCAAGACGCAGCTGAACCTGGGGCATAACGTGAATGCGCAAAGGGAGTTGCGGGGCGA
GGGTGCGGAACTGCGTACGGATAAATGGGTGAGCATCCGGGGCGGTGCGGGAGTGTTTATCAGTGCGGAT
AAACAGCCTTCGGCAGGCGACAGGATGCTGGCAATGGAGGAGGCGATTGCGCAGCTTGAAAATGCCCTGG
GTATTGCGAAAAGCCTGGCGTCGGCAGCGGAATCGGCTCAGGCCCTGCCATCGGATACCGGCAACCAGCA
GACGCTGAACGATGCGCTGAAAGAGCTGGCGCAGCCGGGGATAGTGCTGAATGCGCCGCAGGGCGTGAGC
ATCAGCAGTCCGCAGGCGGTACGGTTGTCTTCGGGTAGCGCCAGCGTGGGGATTGTGTCACAGCAGAATA
CGGACATCAGTGCGCTGAAACGTTTTACGGTGGCGGCGGGAGAAGCCGTCAGCCTGCTGGCGCGAAAGGC
GGGGATGAAGCTGTTTGCGGCGAAGGGAAAGATGGAAATCCAGGCGCAGGATGATGCGCTGGAGGCGACG
GCGAAAAAGGATATCACAGTTACCAGCGTGGAAGGCCGGGTGGAAATCACGGCGGCGAAGGAACTGGTGG
TGAACTGTGCGGGAGCGTATATCAGGCTAAGTGGTGGCAATATCGAGCTGGGCTGCCCGGGGAATATTCT
GCTGAAATCGGCCAATGTGCAGAAAATGGGTAAGGCGGATTTTCGGGTGCCTCCGCTGGAATTGCCTAAA
GGGTTCGAAGAGCGTTTTACTGTCAAAGATCAGAAGACCGGTGAAATTGTTCCGTTTGCCCGTTACCGCA
TCACCACTGAAAAAGGCCAGGTATTCGAAGGCCGGGCAGATGCTGATGGGAAAACGGCCAGCGTTTATAC
CGCATTGCCTGAATCAATAAAAATAGAGCTACTGTGA