SecReT6
Protein ID: 378979434
SecReT6 ID549
T6SS typeN/A
Gene symbol-
Locus tagKPHS_32750
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]3259981..3261678 [-]
Producthypothetical protein
NoteTagL
UniProt IDG8VWZ1, G8VWZ1
KEGG IDkpm:KPHS_32750
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.30E-17, Aligned region: 435..531
Protein Sequence: 565 a.a.     [Download]
>gi|378979434|ref|YP_005227575.1| hypothetical protein KPHS_32750 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MRDNARRLLTILTVILALWLVLGFWPLSIGNQVIFSLCILLAGGAALWRQRRRAVSRQRSEIVLPPEDFQ
GAVVLVCGDTDGLFPGRSAHGETRHGWYLRGDSAEQLPRLAQYLAAARPALVSQVSVLLAVVPEHHPSGE
HLAQSLRDWRRSIVQCRTWLNGLPPVWSVFWVTPPGGQAVESRWFTVTPERPGLQVQQKGQAPQAVAGWQ
REGSPASRLHQTLWLESILTLAENALFRPFRARQAELPPLNLCAAGICLTPVAAVANNLWQQQIAGITTL
SPGNDAAPGPHPLPDLLLSSLPHRHGVSRRMRDAGLAAGVGFLFLALAMLASFINNQRLVRSVGDHLAVY
HRLSGTPPTPKLQAQQRLRADSRLLDDWLRRGEPLRYRLGLYQGGRLIPFVEAAINDWAPPPPPRPVIKQ
VVQGPQTIRLDSMALFDTGKSALKPGSTKLLVNSLLGIKAKPGWLIVVAGHTDSIGNDRSNQQLSLKRAE
AVRDWMRDTGDVPESCFAVQGYGASRPVASNETPEGRAQNRRVEISLVPQKDACLTPGTANTSGAETNGL
KSETE
 
Nucleotide Sequence: 1698 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c3261678-3259981 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGCGTGATAACGCTCGTCGTCTGCTTACGATACTGACCGTCATCCTGGCCCTGTGGCTAGTGCTGGGCT
TCTGGCCGCTGTCCATCGGCAACCAGGTGATCTTCAGTCTGTGCATCCTGCTGGCGGGCGGCGCGGCGCT
CTGGCGTCAGCGTCGCCGGGCAGTCAGCCGTCAGCGATCGGAAATCGTCCTGCCGCCCGAGGATTTTCAG
GGGGCAGTGGTTCTGGTCTGCGGGGATACCGACGGTCTGTTTCCCGGGCGTTCGGCGCACGGCGAAACCC
GTCACGGCTGGTATCTACGGGGAGACAGCGCGGAGCAGTTGCCGCGGCTGGCGCAGTACCTGGCGGCGGC
GCGTCCGGCACTGGTATCGCAGGTTTCCGTGCTGCTGGCGGTGGTACCGGAGCACCACCCCTCCGGGGAG
CATCTGGCGCAGTCGCTGCGCGACTGGCGGCGGAGTATCGTTCAGTGCCGAACCTGGCTAAACGGTCTGC
CGCCGGTGTGGAGCGTGTTCTGGGTGACGCCGCCAGGCGGCCAGGCCGTGGAAAGCCGCTGGTTTACCGT
CACGCCGGAGAGGCCTGGTCTCCAGGTGCAGCAGAAGGGACAAGCGCCCCAGGCGGTTGCCGGGTGGCAG
CGGGAGGGCAGCCCTGCCTCACGCCTGCATCAGACGCTGTGGCTGGAGAGCATTCTGACCTTGGCCGAAA
ACGCTCTTTTCCGGCCATTCCGCGCCCGGCAGGCAGAACTTCCTCCGCTGAACCTGTGTGCCGCGGGCAT
CTGCCTTACGCCGGTGGCGGCGGTGGCGAATAACCTCTGGCAACAGCAAATCGCCGGGATCACCACGCTC
TCCCCGGGCAACGACGCGGCGCCAGGTCCTCACCCGCTGCCGGATCTTCTTCTGTCGTCACTGCCGCACC
GCCACGGGGTCAGCCGCCGGATGCGCGATGCCGGTCTTGCCGCTGGGGTGGGCTTCCTCTTTCTGGCGCT
GGCGATGCTGGCTTCCTTTATCAACAACCAGCGCCTGGTGCGCAGCGTCGGCGATCATCTGGCGGTGTAT
CACCGCCTCAGCGGCACGCCGCCGACGCCGAAGCTGCAGGCGCAGCAGCGTCTGCGTGCCGACAGCCGCC
TGCTGGATGACTGGTTGCGCCGGGGGGAGCCGCTGCGTTATCGGCTGGGGCTGTATCAGGGGGGGCGGCT
GATCCCCTTCGTTGAAGCCGCTATCAATGACTGGGCGCCGCCCCCGCCGCCGCGTCCGGTCATTAAGCAG
GTTGTGCAGGGGCCGCAGACGATCCGCCTCGATAGCATGGCGCTGTTCGATACCGGCAAATCGGCGCTGA
AACCGGGTTCGACAAAGCTGCTGGTGAACTCGCTGCTGGGCATTAAGGCCAAACCCGGCTGGCTGATCGT
GGTGGCAGGCCATACCGACAGCATCGGCAACGATAGATCCAATCAACAACTCTCCCTGAAGCGTGCCGAG
GCGGTCCGCGACTGGATGCGCGATACCGGCGATGTTCCGGAGAGCTGTTTTGCGGTGCAGGGCTACGGCG
CAAGCCGTCCTGTCGCCAGCAACGAGACGCCAGAGGGACGGGCGCAAAATCGCCGGGTGGAGATCAGTCT
GGTCCCGCAGAAGGACGCCTGTCTGACGCCGGGCACGGCCAATACCTCAGGAGCAGAGACTAACGGATTA
AAAAGCGAAACCGAGTAA