SecReT6
Protein ID: 378979435
SecReT6 ID549
T6SS typeN/A
Gene symbol-
Locus tagKPHS_32760
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]3261682..3262335 [-]
Productmembrane protein
NoteTssL
UniProt IDG8VWZ2
KEGG IDkpm:KPHS_32760
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-42, Aligned region: 10..205
Protein Sequence: 217 a.a.     [Download]
>gi|378979435|ref|YP_005227576.1| membrane protein [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MNTSESDLINKTFYPGWLMVSQLRCGQPVTDGEALYRQACRWVTEAREALTAGGVSEASAEQMLYAYCAL
LDESVLNRASQDDGYRRWRKDPLQARFFSTLNAGEELWERIRQLLREPTADAAVLTCFYRTLQLGFVGQY
RAEDDERREDVAQALGARVPPFSMTQEAPVVVRASRLRSGRRMYWCGWAAGIVALAALWLTCSAMLSQMV
AQIAGQG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c3262335-3261682 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAATACCTCTGAAAGCGATCTGATCAACAAAACTTTTTACCCGGGCTGGCTGATGGTCAGCCAGTTAC
GCTGCGGCCAGCCGGTGACGGATGGCGAGGCGCTCTATCGCCAGGCCTGTCGATGGGTGACCGAGGCGCG
CGAGGCGCTGACGGCGGGGGGAGTCAGTGAAGCCAGCGCTGAGCAGATGCTCTATGCCTACTGCGCGCTG
CTCGATGAGAGCGTCCTCAACCGCGCCAGTCAGGATGATGGCTACCGCAGGTGGCGCAAGGATCCGCTGC
AGGCGCGCTTTTTCAGCACTCTCAACGCCGGGGAAGAGCTCTGGGAACGGATCCGCCAGCTGCTGCGAGA
GCCCACGGCGGATGCGGCAGTGCTGACTTGTTTCTATCGTACTTTGCAACTGGGGTTTGTCGGACAGTAC
CGCGCCGAGGATGACGAACGGCGTGAGGACGTGGCGCAAGCGCTTGGCGCGCGGGTCCCGCCGTTCAGCA
TGACCCAGGAGGCGCCGGTGGTGGTTCGTGCCTCCCGGCTGCGCAGCGGACGGCGGATGTACTGGTGCGG
CTGGGCGGCCGGCATTGTGGCGCTGGCGGCGCTGTGGTTGACCTGCTCCGCCATGCTGTCACAGATGGTG
GCGCAGATAGCAGGGCAGGGATAA