SecReT6
Protein ID: 378979436
SecReT6 ID549
T6SS typeN/A
Gene symbol-
Locus tagKPHS_32770
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]3262332..3263672 [-]
Producthypothetical protein
NoteTssK
UniProt IDG8VWZ3
KEGG IDkpm:KPHS_32770
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.40E-129, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|378979436|ref|YP_005227577.1| hypothetical protein KPHS_32770 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MKIFRPLWRDGAFLVPQQFQQQARWDAHVADTVSRMALAHPWGVLRAEFDASALTLSRLNATRLIVRFTD
GTLIDTELADILPPVRDVSDVMQDSVEVLLALPLLSASGGNLDDGQESARPRRWRAEQVTVQELAGHERS
ELAVLRHALTLRLSTEENAAFLTCPVARLVRDAQGQWIVDPEFIPPLLSLAASPTLVSELGELLHRLQAR
RRRLMAMRRESNARMADFAVADVSLFWLLNALNSAEPVLSELHLDPSRHPELLYRELARLAGSLLTFSLE
HHLEAIPRYRHASPEQVFPPLFALLDTLLEVSLPSRVIAIVLEQGADREIWRGRLHDARLREGADFYLSV
RSSLPPHQLQSRFPQLCKAGSHDDVAEVVNIALSGIAIKPLSHVPAAIPLRLENQYFALDLSTDAARAML
EAGNCTFYTPESLGDVKLELFAVLRS
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|378976159|ref|NC_016845.1|:c3263672-3262332 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGAAGATTTTCCGCCCATTATGGCGCGACGGGGCTTTTCTGGTCCCGCAGCAGTTTCAGCAACAGGCCC
GCTGGGACGCGCACGTCGCCGATACGGTCTCCCGCATGGCGCTCGCCCACCCGTGGGGGGTATTGCGCGC
GGAGTTTGACGCGAGCGCGCTCACCCTTTCCCGGCTCAACGCTACCCGGCTGATCGTGCGTTTCACCGAC
GGAACGCTGATTGACACCGAGCTGGCGGATATTTTGCCACCGGTCCGCGATGTATCGGACGTGATGCAGG
ACAGCGTGGAGGTTCTGCTCGCTCTGCCGCTGCTCAGCGCCAGCGGCGGCAATCTTGATGACGGCCAGGA
GAGCGCCCGCCCGCGCCGCTGGCGCGCCGAGCAGGTGACCGTCCAGGAGCTGGCCGGCCATGAACGCAGC
GAGCTGGCCGTTCTGCGGCACGCGCTAACGCTGCGTCTCTCCACCGAGGAAAATGCAGCCTTCCTCACCT
GCCCGGTAGCGCGTCTGGTGCGCGACGCCCAGGGGCAGTGGATCGTTGACCCGGAATTCATCCCGCCGCT
GCTGTCGCTGGCGGCAAGCCCGACGCTGGTCAGCGAGCTGGGCGAGCTGTTACATCGCCTGCAGGCCCGA
CGCAGACGCCTGATGGCCATGCGTCGTGAAAGCAATGCGCGGATGGCTGATTTTGCCGTGGCGGATGTTT
CCCTGTTCTGGCTGCTCAACGCGCTGAACAGCGCTGAACCGGTGCTCAGCGAGCTGCATCTGGATCCCTC
GCGCCATCCGGAGCTGCTTTATCGCGAACTGGCCAGGCTGGCCGGCAGTCTGCTGACTTTCTCCCTTGAA
CATCATCTGGAAGCAATCCCCCGCTACCGGCATGCCTCGCCAGAGCAGGTATTCCCACCGCTGTTTGCCC
TGCTGGATACGCTGCTCGAAGTCAGCCTGCCCTCAAGGGTGATCGCCATCGTTCTGGAGCAGGGCGCCGA
CCGGGAGATCTGGCGGGGCAGGCTGCACGATGCGCGGCTGCGCGAGGGGGCGGATTTTTATCTGTCGGTG
CGCTCTTCACTCCCCCCTCACCAGCTACAGAGCCGCTTTCCGCAGCTCTGTAAGGCGGGTAGCCATGATG
ATGTCGCCGAGGTCGTCAATATTGCCCTCAGCGGCATCGCGATCAAACCGCTGAGCCATGTGCCGGCGGC
CATTCCGCTACGTCTGGAAAACCAATATTTCGCTCTGGATCTCTCCACCGATGCCGCCCGCGCGATGCTG
GAGGCCGGCAACTGCACCTTCTATACCCCGGAATCGCTTGGCGACGTGAAACTTGAACTCTTTGCGGTAC
TGCGCTCATGA