SecReT6
Protein ID: 378982805
SecReT6 ID553
T6SS typei3
Gene symbol-
Locus tagSTMDT12_C02640
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. T000240
Repliconchromosome [GenBank: NC_016860] [Browse all T6SS(s) in this replicon]
Location [Strand]306724..308607 [-]
Producthypothetical protein
NoteTssF
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.10E-210, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|378982805|ref|YP_005245960.1| hypothetical protein STMDT12_C02640 [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240]
MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPYVERMIEAFSFLSARTQLKIDAEFPR
FTQRLLEVVSPNYVTPTPSMAVVKLYPDTQEGDLAKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWP
LSIEEVRLTAAPPDMPALHRYLPPNIHVAGALRITLRTFGELTFSELAGPARLPFYLCGEERIASHLFEL
LHTSAVATLAGEPGHFDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTG
LSAGLQKVQGNVAEIVILLNRLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRIEVTHSVTEQHLVVDRT
RPLDYEVFSVHEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRREPRRSSENARRYGTRTPYTGSE
VFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRNGRDDLTVDAAIPVAGVGLIRPPRPPQPPLAER
EMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLV
YGRGVSCELTVDEEGFSGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGHVMTWPVRTGQRGSV
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|378982542|ref|NC_016860.1|:c308607-306724 Salmonella enterica subsp. enterica serovar Typhimurium str. T000240, complete genome
ATGGATCCACGGCTACTGGAGTATTACAACCGCGAACTGAGCTACCTGCGGGAGACCGGTGCTGAGTTCG
CCACCCTCCATCCCAAAATTGCCGCCCGACTGGGGATGCAGGGAACCGATATTGCCGACCCGTATGTGGA
ACGCATGATCGAGGCGTTCAGCTTTCTGAGCGCCCGCACTCAGCTAAAAATTGACGCCGAGTTTCCCCGC
TTCACACAGCGGTTACTGGAAGTCGTCAGCCCCAATTACGTCACCCCCACGCCATCGATGGCAGTGGTAA
AGCTGTATCCCGATACGCAGGAAGGCGACCTGGCGAAAGGGGTCACCGTGCCGCGCGATACCGCGTTCGT
TTCCCCCATCCCGGAAGGCGAAAATACCGCCTGCCAGTTTCGCAGCAGCCAGGACGTCACGCTGTGGCCG
CTGTCCATCGAGGAGGTACGCCTGACCGCCGCGCCGCCGGATATGCCCGCCCTGCACCGCTATCTGCCGC
CTAATATTCATGTCGCCGGGGCATTGCGCATCACCCTGCGAACCTTCGGGGAACTGACTTTCAGCGAGCT
GGCCGGTCCGGCACGGCTGCCCTTTTACCTCTGCGGCGAAGAACGCATTGCGTCACACCTGTTTGAGCTG
CTACATACCAGCGCCGTCGCCACACTGGCCGGTGAACCCGGTCACTTTGACGGCGAACTGAATGTGAATC
TTCAACACCCGGTGGCGCACGAAGGGCTGGAGCCAGGGCAGGGGCTGCTACCGCTCGCCTGGAACGTGTT
TCACGGCCATAATCTGCTGCATGAATTTTTCGCCTGTCCGGAACGGTTTTACTTCTTCACCCCGACCGGA
TTGTCTGCCGGGTTACAAAAGGTGCAGGGCAATGTGGCGGAAATTGTCATACTGCTTAACCGCCTGCCGC
CGGACTGGCTGATTCATCAGACGGACGCTGCACAGTTCAGCCTGTTCTGTACGCCGGTGATCAACCTGTT
TCCTCGCACCACCACCCGGATTGAAGTCACTCACAGCGTGACGGAACAGCATCTGGTGGTGGATCGTACC
CGTCCGCTGGATTACGAGGTGTTTTCTGTTCATGAAGTCGAAGGCCTGGAAGCGGAAACCACACGGAAGA
TGATTTTTCGTCCGCTGTATCACACCCGTAATAATGACGAAGGCAACCACGGGCGTTATTTTTCACTGCG
TCGTGAACCGCGCCGCTCGTCAGAAAACGCCCGCCGCTATGGCACCCGAACCCCCTATACCGGCTCGGAA
GTCTTCCTCTCGCTGGTTGATCAGCATGAAGCGCCCTACCCGGAAAATCTGCGCCATATCACCGTCACGG
CAATGGTGACTAACCGCGATCTGCCCTGCCTTATTCCACGTAATGGCCGGGATGATCTGACCGTAGATGC
GGCGATTCCGGTGGCGGGCGTGGGTCTTATCAGACCGCCGCGCCCGCCGCAGCCGCCGCTGGCTGAACGC
GAAATGGCCTGGCGGCTGATCCGGCAGTTGTCGTTTAATTATCTGCCGCTGGCCGATCTGGATCACCGCA
CCGGCGGCCAGGCGCTGCGCGATCTGCTGAATCTGTTTATCCCGGCTCACGACAGCCCGCAGTCGCGCCA
GGTGCGCAGCCTGATTGGCTGCAAAACCACCCCGGTGACCCGCCGCCTGCCCGGCTCCGGCCTGTTGGTC
TATGGCCGGGGCGTCAGTTGCGAACTGACCGTGGACGAAGAAGGATTTTCCGGTATCAGTCCTTACCTGT
TCGGTCTGGTGCTGGAACACTATATTGCCCGCCATGTTTCCATTAATACCTTCTCGCAGATGACGCTGCA
CTCGATGCAACGCGGGCATGTCATGACCTGGCCGGTCAGAACCGGGCAACGGGGGAGCGTATGA