SecReT6
Protein ID: 378982806
SecReT6 ID553
T6SS typei3
Gene symbol-
Locus tagSTMDT12_C02650
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. T000240
Repliconchromosome [GenBank: NC_016860] [Browse all T6SS(s) in this replicon]
Location [Strand]308623..309117 [-]
Productputative cytoplasmic protein
NoteTssE
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.40E-22, Aligned region: 35..147
Protein Sequence: 164 a.a.     [Download]
>gi|378982806|ref|YP_005245961.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240]
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGDIDARRYPQAA
ASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLLDKTRQGSYNTLQFEIRGQIL
TQPYPTEFLVRSALDMELSRITFF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|378982542|ref|NC_016860.1|:c309117-308623 Salmonella enterica subsp. enterica serovar Typhimurium str. T000240, complete genome
ATGAGCACGTCTCGTTTTACACCCGCTAACCACCTGCTGCCCACGCTGTTTGATCGGCTGTGTGACAATG
CTCCGTATCAGAAAATTGACCGGGATATCAGCGTCACGCCGGTACAACTGAAGGAGATCATTCGCCGGGA
TCTCTCCTTTTTGCTCAATACCATTAGCCACGAGGGTGACATCGACGCCCGGCGCTATCCGCAGGCGGCG
GCGTCAGTGCTCAACTATGGCCTGCCGCCGCTGGCGGGCAGCTTTATGTATGAGCATAAGTGGGACGATA
TCAGCGAGGCGATCCGGCGCGCCATTATCCGTTTCGAACCCCGGCTGAACGCCGCCACACTCAGGGTCAC
GCCCTTGCTCGATAAAACCCGGCAGGGTAGCTATAACACGCTACAGTTTGAAATTCGCGGACAAATTCTG
ACGCAGCCGTATCCCACGGAGTTTCTGGTACGCAGCGCGCTGGATATGGAGCTGAGCCGCATTACGTTCT
TTTAA