SecReT6
Protein ID: 378982815
SecReT6 ID553
T6SS typei3
Gene symbol-
Locus tagSTMDT12_C02740
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. T000240
Repliconchromosome [GenBank: NC_016860] [Browse all T6SS(s) in this replicon]
Location [Strand]318680..319165 [+]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-42, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|378982815|ref|YP_005245970.1| hemolysin-coregulated protein [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240]
MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLSFEHYIDRASPNLF
KYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIASRESIELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|378982542|ref|NC_016860.1|:318680-319165 Salmonella enterica subsp. enterica serovar Typhimurium str. T000240, complete genome
ATGTCTTATGACATTTTTCTGAAAATTGACGGCATTGACGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGTCTCGG
TTCCGGTAAGGTCTCCGTCACTAATCTTTCATTTGAACATTACATCGATCGCGCCAGCCCGAACCTGTTC
AAATACTGCTCTTCCGGTAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTACACTTTCACAGATCTGATTATTGCAATGGTATCGCCCAGCGGAAGCCAGGGAGG
GGAAATTGCGTCTCGCGAATCAATTGAACTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGTGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA