SecReT6
Protein ID: 378987664
SecReT6 ID554
T6SS typei3
Gene symbol-
Locus tagSTMUK_0268
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. UK-1
Repliconchromosome [GenBank: NC_016863] [Browse all T6SS(s) in this replicon]
Location [Strand]304654..305709 [-]
Productputative cytoplasmic protein
NoteTssA
UniProt IDF5ZM44
KEGG IDsej:STMUK_0268
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.60E-18, Aligned region: 51..110
ImpA-rel_N [PF06812], Evalue: 1.60E-18, Aligned region: 224..241
Protein Sequence: 351 a.a.     [Download]
>gi|378987664|ref|YP_005250828.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1]
MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIR
VLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAESIEDASLARSNALAALLDHEG
VMADIRGITLSNSAALRLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQ
VWARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGI
SLPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDAL
E
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|378987404|ref|NC_016863.1|:c305709-304654 Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 chromosome, complete genome
ATGGACATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGATCCGG
AATACCTGCTGCTGTTCAGCCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCC
GGAAGCCGTGAACTGGCCGGAAATTGAACGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGG
GTGTTGATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCACAC
AACTGGCAGAACTGAGCGTAATCTGGTCTGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCATC
CGCAGAATCTATTGAAGATGCGTCGCTGGCGCGCAGTAATGCCCTGGCGGCGCTGCTGGATCACGAAGGC
GTGATGGCGGACATTCGCGGTATTACGCTGTCAAACAGTGCCGCCCTGCGCCTACAGGTACGGGATGTGG
AGCGCGCGTTATCCGCTCCCCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCCGA
CCTCGAAGCCCGTGGGGCATTACCGCTGGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAA
GTGTGGGCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGC
TGCCTGACGTGGTACAGACAACCACACCGGAAATCCCTCCGTCGCCAGCGCCAGTGCCAGACCCCGCAGG
CACGGTTATGGATAATGCCGTTCCGGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATA
TCCCTCCCACACAATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAACGCCTGCGGTGCA
TTCGTCGCTGGTTTGAGAGCAGTGAACCCAGTAGCCCGACCATCCCACTGTTACGCCAGGCTGAAAGACT
GGTGGGAAAACGGTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTG
GAGTGA