SecReT6
Protein ID: 378987671
SecReT6 ID554
T6SS typei3
Gene symbol-
Locus tagSTMUK_0275
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. UK-1
Repliconchromosome [GenBank: NC_016863] [Browse all T6SS(s) in this replicon]
Location [Strand]313922..314464 [+]
Productputative cytoplasmic protein
NoteTssB
UniProt IDF5ZM51
KEGG IDsej:STMUK_0275
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.70E-60, Aligned region: 11..164
Protein Sequence: 180 a.a.     [Download]
>gi|378987671|ref|YP_005250835.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1]
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKSAATQQDVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|378987404|ref|NC_016863.1|:313922-314464 Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 chromosome, complete genome
ATGGCTATCAACAATAGCGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGTTCCGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
CGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGCATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCTGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACGCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACTCAACTGGCGAACCTCCAGACCTACATGGATGGCAAGGCG
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACTCTGCTGAAAACGCTGGCGAATGCGCCGA
AATCGGCCGCTACCCAGCAAGATGTGTCAGCGGATAATGAATCAGCGGAATAA