SecReT6
Protein ID: 378987672
SecReT6 ID554
T6SS typei3
Gene symbol-
Locus tagSTMUK_0276
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. UK-1
Repliconchromosome [GenBank: NC_016863] [Browse all T6SS(s) in this replicon]
Location [Strand]314488..315981 [+]
Productputative cytoplasmic protein
NoteTssC
UniProt IDF5ZM52
KEGG IDsej:STMUK_0276
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.30E-191, Aligned region: 64..490
Protein Sequence: 497 a.a.     [Download]
>gi|378987672|ref|YP_005250836.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1]
MANSNMQATDAVAQDTASASGEFDALLNQAFRPKTTQAAKAVEAAVQTLANTITVSDDAYKSISAIIAQI
DFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWDQSPMF
KKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQELANPR
DLTKIVTQNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVWSNAA
YAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFIPL
IHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKEREDMQR
WLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRLVTKLP
SVKQGNA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|378987404|ref|NC_016863.1|:314488-315981 Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 chromosome, complete genome
ATGGCAAACAGTAATATGCAGGCAACCGACGCGGTTGCTCAGGATACCGCCTCCGCATCCGGTGAATTTG
ATGCGTTGCTGAATCAGGCCTTCCGACCCAAGACTACCCAGGCGGCAAAAGCCGTGGAAGCCGCGGTGCA
GACGCTGGCGAACACGATCACCGTCAGCGATGACGCCTATAAAAGCATCAGCGCTATTATTGCGCAGATC
GACTTTAAACTGACCGAACAGATCAAACTGATCCTGCAACATCCCGACTGGCAGAAGCTGGAATCCTCGT
GGCGCGGTATGGAGCATCTGGTTTACAACACCGAGACCGACGAAAAGCTGAAAATTCGCTTCATGAATCT
GTCAAAAGATGAATTGCGGCGCAACATGAAGCGTTACAAGGGCATCGCCTGGGATCAAAGCCCGATGTTC
AAGAAACTGTATGAAGCCGAATACGGCCAGTTAGGTGGCGAACCTTATGGCTGTATCATTGCGGATTACT
ACTTCGACCATACACCGCCCGATGTGGATCTGCTTGGCTCTATCGCCAAAGTCGCCGCGTCGGCCCATGC
GCCGTTTATTGCCGGGGCTTCCCCCTCGGTACTGCAAATGGACTCCTGGCAGGAACTGGCGAATCCCCGC
GACCTGACCAAAATCGTCACCCAGAACCTGGAATATGCGCCGTGGAACTCGCTGCGGGCTAGCGAAGACT
CCCGTTATATTGGCCTGACGATGCCGCGTTTTCTTGCCCGCCTGCCGTATGGCGCAAAAACCAACCCGGT
GGACGAGTTTGATTTTGAAGAAGATGCGGATGGTTCTGACCATACCAAATACGTCTGGAGCAACGCGGCC
TACGCGATGGGCGTAAACATCAACCGTTCCTTCAAACACTACGGCTGGTGTACGTTGATTCGCGGTGTGG
AATCAGGCGGTGCGGTGGAAAATCTTCCCTGCCATACCTTCCCGACTGACGATGGCGGCGTGGACATGAA
ATGCCCGACCGAAATCGCCATCTCTGACCGCCGCGAGGCTGAACTGGCGAAAAACGGTTTTATCCCGTTG
ATCCACCGTAAAAACTCAGACTATGCCGCCTTTATCGGCGCACAGTCGCTGCAAAAACCACAGGAATACT
ACGATCCGGACGCGACGGCCAACGCTAACCTGTCTGCCCGTCTACCGTACCTGTTCGCCTGCTCGCGCTT
CGCTCACTTCCTCAAATGTATCGTCCGCGACAAAATCGGTTCCTTTAAAGAGCGTGAGGATATGCAGCGC
TGGCTAAATGAATGGATTATGAATTATGTCGACGCCGATCCGGTGAACTCCTCGCAAGAAACTAAAGCCC
GTCGTCCGCTGGCTGCCGCTGAAGTAGTGGTGGAAGAGGTCGAAGGCAATCCAGGTTATTACGACGCGAA
ATTCTTCCTGCGTCCGCATTTCCAGCTTGAAGGGCTGACGGGATCGCTGCGCCTGGTGACAAAACTGCCG
TCAGTGAAGCAGGGCAATGCCTGA