SecReT6
Protein ID: 378987681
SecReT6 ID554
T6SS typei3
Gene symbol-
Locus tagSTMUK_0285
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. UK-1
Repliconchromosome [GenBank: NC_016863] [Browse all T6SS(s) in this replicon]
Location [Strand]321085..322389 [+]
Producthypothetical protein
NoteTssL
UniProt IDF5ZM61
KEGG IDsej:STMUK_0285
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.00E-61, Aligned region: 62..266
OmpA [PF00691], Evalue: 4.90E-16, Aligned region: 193..211
OmpA [PF00691], Evalue: 4.90E-16, Aligned region: 328..426
Protein Sequence: 434 a.a.     [Download]
>gi|378987681|ref|YP_005250845.1| hypothetical protein STMUK_0285 [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1]
MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIVEDGPDSKLRLAEISAAANPLLAAARP
LLCALAAMPAKLDAALVEPYRNLLVREMHLYQTLCDQANLRREHVLAVRYCLCTALDEAANNTTWGRRGV
WAGKSLLVTFHGESEGGIKLFQIIGRLAASFQEHGNVLEVIYHLLGLGFEGRYSVQPDGRKQLDNIRQQL
LTQLSQRRDPVMPALSPDFQGAISGRLRRMRRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQHIDA
IGIKLPPPPVPVHKLRLKILLANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQKTVSDAIRPVINKAARE
IARVGGAVTVTGHTDSQPIHSAEFPSNLVLSEKRAAEVAALLTSGGVPAGRVHIVGKGDTVPVADNGSKA
GRAKNRRVEILVVE
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|378987404|ref|NC_016863.1|:321085-322389 Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 chromosome, complete genome
ATGACAGACAGTACCCTGACGCCGCCAGCGGCGGATATGATGTCCTTTTTGTCCACCACGCCGGAACATA
AGGACAGTGAATATGAAACGCCGGTACACACCAGCCAGCGCACGGAACTCAATGTCATCGTTGAAGACGG
TCCGGACAGCAAACTCCGGCTGGCTGAAATCAGCGCGGCGGCTAACCCGTTGCTCGCCGCTGCCCGGCCT
TTATTGTGCGCTCTCGCAGCCATGCCCGCTAAACTGGATGCGGCCCTGGTAGAGCCTTACCGTAATCTGC
TGGTACGCGAGATGCATCTGTACCAGACATTATGCGATCAGGCGAACCTGCGGCGCGAGCACGTACTGGC
GGTACGTTACTGCCTGTGTACGGCGCTTGATGAAGCCGCCAATAACACAACCTGGGGACGGCGCGGCGTC
TGGGCCGGAAAAAGCCTGCTGGTAACATTTCATGGTGAAAGCGAAGGCGGGATAAAACTTTTCCAGATCA
TCGGGCGTCTGGCGGCCAGCTTCCAGGAGCATGGCAACGTACTGGAGGTTATCTACCACCTGCTGGGGTT
GGGATTTGAAGGCCGCTACAGCGTGCAGCCAGACGGGCGTAAGCAACTGGACAATATTCGCCAGCAACTG
CTGACACAGCTTTCACAGCGTCGCGATCCGGTTATGCCCGCGCTCTCGCCTGACTTTCAGGGGGCGATAA
GCGGACGACTGCGGCGGATGCGCCGGGTGCCGGTCTGGCTGAGCGCCGGGATAGCCCTGTTGGCGATGCT
GACGCTGTTTGGCCTTTACAGCCACCGGATGGATGTGCAGACCGTCACCGTACAACAGCATATTGATGCG
ATTGGTATAAAACTGCCGCCGCCGCCTGTGCCGGTTCATAAGCTGCGGCTGAAAATCCTGCTGGCAAACG
AAATCGCCCGTGGCCTGCTGACCGTGGACGAAGATGACCAGCACAGTAGGGTGGTCTTCCGTGGCGACGC
CATGTTTGTGCCGGGACAGAAAACGGTGAGTGACGCAATCCGGCCAGTGATTAACAAAGCGGCGCGGGAA
ATCGCCCGCGTGGGCGGCGCAGTCACTGTAACGGGTCACACTGACAGCCAGCCCATTCATTCGGCTGAAT
TCCCATCCAACCTGGTACTGTCGGAAAAACGGGCGGCGGAAGTTGCGGCGTTGCTGACCTCCGGCGGCGT
ACCTGCCGGACGGGTACATATCGTCGGCAAGGGCGATACGGTGCCGGTGGCGGATAACGGCAGTAAAGCC
GGGCGGGCGAAAAACCGTCGGGTGGAAATTCTGGTAGTGGAGTGA