SecReT6
Protein ID: 379703933
SecReT6 ID544
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4567
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]22..2739 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDH2J152
KEGG IDraq:Rahaq2_4567
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-40, Aligned region: 261..280
AAA_2 [PF07724], Evalue: 1.90E-40, Aligned region: 635..799
AAA [PF00004], Evalue: 7.00E-19, Aligned region: 263..375
AAA [PF00004], Evalue: 7.00E-19, Aligned region: 640..762
AAA_5 [PF07728], Evalue: 4.90E-15, Aligned region: 263..285
AAA_5 [PF07728], Evalue: 4.90E-15, Aligned region: 360..393
AAA_5 [PF07728], Evalue: 4.90E-15, Aligned region: 639..760
ClpB_D2-small [PF10431], Evalue: 2.90E-14, Aligned region: 408..432
ClpB_D2-small [PF10431], Evalue: 2.90E-14, Aligned region: 806..881
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 117..224
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 240..285
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 307..341
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 520..589
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 622..683
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 703..733
AAA_16 [PF13191], Evalue: 3.50E-12, Aligned region: 778..829
AAA_25 [PF13481], Evalue: 6.00E-09, Aligned region: 263..287
AAA_25 [PF13481], Evalue: 6.00E-09, Aligned region: 317..351
AAA_25 [PF13481], Evalue: 6.00E-09, Aligned region: 637..668
AAA_22 [PF13401], Evalue: 3.80E-07, Aligned region: 84..132
AAA_22 [PF13401], Evalue: 3.80E-07, Aligned region: 262..348
AAA_22 [PF13401], Evalue: 3.80E-07, Aligned region: 586..623
AAA_22 [PF13401], Evalue: 3.80E-07, Aligned region: 638..660
AAA_17 [PF13207], Evalue: 6.30E-07, Aligned region: 263..394
AAA_17 [PF13207], Evalue: 6.30E-07, Aligned region: 638..675
AAA_17 [PF13207], Evalue: 6.30E-07, Aligned region: 822..841
NACHT [PF05729], Evalue: 1.90E-06, Aligned region: 263..346
NACHT [PF05729], Evalue: 1.90E-06, Aligned region: 639..662
Arch_ATPase [PF01637], Evalue: 3.30E-06, Aligned region: 241..279
Arch_ATPase [PF01637], Evalue: 3.30E-06, Aligned region: 315..413
Arch_ATPase [PF01637], Evalue: 3.30E-06, Aligned region: 633..652
Arch_ATPase [PF01637], Evalue: 3.30E-06, Aligned region: 708..731
IstB_IS21 [PF01695], Evalue: 3.40E-06, Aligned region: 257..324
IstB_IS21 [PF01695], Evalue: 3.40E-06, Aligned region: 639..657
AAA_14 [PF13173], Evalue: 9.60E-06, Aligned region: 263..364
AAA_14 [PF13173], Evalue: 9.60E-06, Aligned region: 638..729
AAA_19 [PF13245], Evalue: 1.10E-05, Aligned region: 260..286
AAA_19 [PF13245], Evalue: 1.10E-05, Aligned region: 637..661
DUF258 [PF03193], Evalue: 2.60E-05, Aligned region: 182..236
DUF258 [PF03193], Evalue: 2.60E-05, Aligned region: 250..280
DUF258 [PF03193], Evalue: 2.60E-05, Aligned region: 639..651
Zeta_toxin [PF06414], Evalue: 6.90E-05, Aligned region: 257..287
Zeta_toxin [PF06414], Evalue: 6.90E-05, Aligned region: 638..679
Sigma54_activat [PF00158], Evalue: 0.00013, Aligned region: 246..277
Sigma54_activat [PF00158], Evalue: 0.00013, Aligned region: 638..756
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 263..292
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 640..664
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 164..190
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 263..280
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 482..559
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 637..663
Clp_N [PF02861], Evalue: 0.0019, Aligned region: 45..87
Clp_N [PF02861], Evalue: 0.0019, Aligned region: 126..146
SRP54 [PF00448], Evalue: 0.0022, Aligned region: 263..285
SRP54 [PF00448], Evalue: 0.0022, Aligned region: 638..684
RNA_helicase [PF00910], Evalue: 0.0036, Aligned region: 264..285
RNA_helicase [PF00910], Evalue: 0.0036, Aligned region: 640..661
AAA_33 [PF13671], Evalue: 0.0041, Aligned region: 263..280
AAA_33 [PF13671], Evalue: 0.0041, Aligned region: 638..657
AAA_33 [PF13671], Evalue: 0.0041, Aligned region: 774..837
AAA_29 [PF13555], Evalue: 0.0079, Aligned region: 257..279
AAA_29 [PF13555], Evalue: 0.0079, Aligned region: 637..650
Protein Sequence: 905 a.a.     [Download]
>gi|379703933|ref|YP_005220307.1| type VI secretion ATPase, ClpV1 family [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MGLGFLQRKWLRAVAYPKKELSMEHQSAVLLRRLNPYCAKALEAAATLCQTRAHSEITVEHWLLKLLELG
EGDITVLARRYEWDMDTLWQSLLAHLDALPRSVHSRPQLSQDLQALMKAGWLAASLQDDNQNIRSVNLLE
ALIEQPRLLHCEGLWPLFSLSEEHIRRLKPVLDTLSEERPELQQQESLKRMSSSLSDNTAISKHDAGMGG
QSLSEALQAALDKFTLDVTAKAKAGQIDPVFGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLA
LRIAEGNVPDSLKTVSLRTLDLGLLQAGAGVKGEFEQRLKNIIDAVQQSPTPVLLFIDEAHTIIGAGNQA
GGADAANLLKPALARGELRTIAATTWSEYKQYFERDAALERRFQIVKVDEPDDEMACLMLRGLKSRYAQH
HGVHITDEAVKAAVSLSRRYITGRQLPDKAVDLLDTASARVRMSLDTLPEDLIRLKAQITALEMEEQALL
EDIVLGNKTHGDRLEQIEQQADNLCEQLTALNTQYHAEKNLTQQLLETRQDISRQEEIASLQEQLSDLQG
NTPLLSLDVDVRTVANVIADWTGVPLTSLLKDEQTDLLQLEDHLNKRVVGQDHVLTDMAQRLRAAKTGLT
SENGPLGVFLLVGPSGVGKTETALSLADCLFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGIL
TEAVRKRPYSVVLLDEVEKAHRDVINLFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHLMQLLDER
PEATDSDLQELLRPILRDHFQPALLARFQTLIYRPLNAVALRTIVEMKLAQVAKRLNKHYGLTCSIEESL
YNTLVTACLLPDTGARNIDSLLNQQILPVLSQQLLQRKAGQQCTTALALGWDEEEGITLEFDGEE
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|379703932|ref|NC_016835.1|:22-2739 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGGGCCTGGGTTTCCTGCAACGGAAATGGCTAAGGGCGGTAGCGTACCCAAAAAAGGAACTCAGCATGG
AACATCAGTCAGCCGTATTACTTCGCCGCTTAAACCCGTATTGCGCCAAAGCACTGGAAGCCGCCGCAAC
GCTCTGCCAGACCCGCGCTCACAGTGAAATTACCGTCGAGCACTGGCTGCTCAAATTGCTGGAACTGGGC
GAAGGTGACATTACCGTACTGGCCCGCCGCTACGAGTGGGATATGGACACCTTATGGCAAAGCCTGCTGG
CGCACCTCGACGCCCTGCCTCGTTCCGTGCATTCCCGCCCGCAACTTTCTCAGGATCTACAGGCACTGAT
GAAAGCGGGCTGGCTCGCAGCGTCACTTCAGGATGACAATCAGAACATCCGCAGCGTCAATCTGCTGGAA
GCACTGATAGAGCAGCCGCGCCTGCTGCATTGCGAAGGATTATGGCCGCTGTTCAGCCTGAGCGAAGAGC
ATATCCGACGCCTTAAACCGGTGCTGGATACATTGTCCGAAGAACGTCCGGAGCTGCAACAACAGGAAAG
CCTCAAGCGGATGTCATCGTCGCTCTCCGATAATACTGCCATTTCTAAACATGATGCAGGTATGGGCGGC
CAGTCATTAAGCGAAGCGCTGCAGGCCGCACTGGATAAATTTACGCTGGATGTCACCGCAAAAGCCAAAG
CCGGGCAGATTGATCCGGTATTTGGCCGCGACAATGAAATCCGTCAGATGGTCGATATTCTCTCCCGCCG
CCGTAAAAACAACCCGATTCTGGTCGGCGAACCGGGCGTGGGGAAAACCGCACTGGTCGAAGGCCTGGCA
TTACGCATTGCGGAAGGCAACGTGCCGGACAGCCTCAAAACCGTTAGTTTGCGCACGCTGGATTTGGGTC
TGTTGCAGGCCGGTGCCGGTGTGAAAGGTGAGTTTGAGCAGCGTCTGAAAAATATTATCGATGCCGTGCA
ACAGTCGCCAACGCCGGTTCTGCTGTTTATAGATGAAGCCCATACCATTATCGGTGCCGGTAATCAGGCC
GGTGGTGCAGATGCCGCTAACCTGCTAAAACCGGCCCTTGCCCGTGGCGAGCTGCGCACTATCGCTGCCA
CCACCTGGTCTGAGTACAAACAGTATTTTGAGCGCGACGCTGCCCTTGAGCGCCGCTTCCAAATCGTCAA
AGTCGATGAGCCGGATGACGAGATGGCCTGCCTGATGCTGCGCGGCCTGAAATCCCGTTACGCTCAACAT
CATGGCGTCCATATTACTGACGAAGCGGTAAAAGCCGCCGTCAGCCTTTCCCGCCGTTATATCACAGGTC
GCCAGTTACCCGACAAAGCGGTCGATCTGCTTGATACTGCGTCTGCGCGCGTGCGCATGAGCCTTGATAC
TCTGCCTGAAGATCTGATACGTCTGAAAGCGCAAATCACCGCGCTGGAAATGGAAGAACAAGCACTGCTG
GAAGATATCGTGCTGGGCAATAAAACGCACGGCGACCGTCTGGAACAGATTGAACAACAGGCTGACAACT
TATGCGAACAGCTTACTGCGCTGAACACTCAGTACCATGCGGAAAAAAACCTGACACAACAATTGCTGGA
GACCCGTCAGGACATCAGCCGTCAGGAAGAAATCGCCAGCCTGCAAGAACAACTGAGTGATTTGCAGGGC
AATACGCCGCTGCTGTCCCTGGACGTTGATGTGCGTACCGTCGCGAACGTGATCGCTGACTGGACCGGCG
TGCCGCTCACCAGCCTGCTGAAAGATGAGCAGACTGATTTACTGCAACTGGAAGATCACCTGAACAAACG
CGTCGTCGGGCAGGATCATGTGCTGACCGATATGGCACAGCGTCTGCGCGCCGCTAAAACCGGCCTGACA
TCCGAGAATGGTCCGTTGGGTGTGTTTCTGCTGGTCGGTCCGAGTGGCGTGGGTAAAACCGAGACCGCAC
TTTCCCTTGCTGACTGTCTGTTCGGCGGCGAGAAATCCCTCATAACCATCAACCTCAGCGAGTATCAGGA
AGCGCATACCGTTTCCCAGCTGAAAGGTTCACCTCCCGGTTATGTCGGTTACGGTCAGGGCGGCATTCTC
ACCGAAGCCGTGCGTAAACGCCCCTACAGCGTCGTGCTGCTCGATGAAGTGGAAAAGGCGCACCGCGACG
TCATTAACCTGTTTTATCAGGTATTCGACCGTGGTTTTATGCGCGACGGTGAAGGACGTGAAATCGACTT
CCGCAATACCGTGATCCTGATGACCGCCAATCTCGGCAGCGACCACCTGATGCAACTGCTGGATGAACGG
CCGGAAGCCACTGACAGCGATTTACAGGAACTTCTGCGCCCGATCCTGCGCGATCATTTCCAGCCCGCCC
TGCTCGCCCGTTTTCAGACGCTGATTTATCGTCCGCTGAACGCCGTCGCACTGCGCACTATCGTTGAGAT
GAAACTGGCACAAGTCGCGAAACGTCTGAACAAGCACTATGGCCTGACCTGCTCCATCGAAGAAAGTCTG
TACAACACGCTGGTCACCGCCTGCCTGCTACCTGACACCGGCGCGCGCAACATCGACAGCCTGCTAAATC
AGCAGATCCTGCCGGTGCTGAGCCAGCAATTGCTGCAACGCAAGGCCGGACAACAGTGCACAACGGCACT
GGCACTGGGCTGGGATGAAGAGGAAGGGATCACACTGGAATTTGACGGAGAAGAGTAA