SecReT6
Protein ID: 379703934
SecReT6 ID544
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4568
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]2739..5126 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDH2J153
KEGG IDraq:Rahaq2_4568
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.10E-66, Aligned region: 35..349
Phage_GPD [PF05954], Evalue: 4.10E-66, Aligned region: 677..703
DUF2345 [PF10106], Evalue: 5.10E-39, Aligned region: 536..555
DUF2345 [PF10106], Evalue: 5.10E-39, Aligned region: 605..745
T6SS_Vgr [PF13296], Evalue: 4.00E-34, Aligned region: 481..586
T6SS_Vgr [PF13296], Evalue: 4.00E-34, Aligned region: 622..644
Phage_base_V [PF04717], Evalue: 1.90E-14, Aligned region: 394..476
Protein Sequence: 795 a.a.     [Download]
>gi|379703934|ref|YP_005220308.1| Rhs element Vgr protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MSTSDVINRLLNQSRYRLDVSQSPAFLDVLRFEGEEQLSKPFEYIIHVTSTATDLTAEQLVLKPATFTMQ
APVFDIAGVAEPVRAVHGVIQHFSRISTSADQTIYRLVLVPRVALLDHTAKCALYLNQSVQEVVEKVLRA
HGLEGPDFEFQLSRSYPARELITQWRETDLAFIQRLLAEVGIYWHLEMDTRLEHDVIIFADSQQQYKFGI
RLPLRNQAGMSDSGTESVWGLSTKHQVVTQQVSTRDYNYREALSPMDTTASAAGSDETTIGEVYQYAEPF
LQSGSEDGVETGAFYARLRHERILNAQKSVTGHSSCPHLAPGQVLEVDGTLPAVLNEGILLTGIKTYGSR
KSRFTAHLTGQPYSETVCFRPALPQRPVIAGTLPARVESTTKGDIYSWLDNQGRYRVKLDFDRDEQEQGY
AYLWLRMAKPYAGDTYGWHAPLIDGTEVAIAFDSGDCDRPYIAYALHDSAHSDHVTDDNHTRNVLRTPSF
NKLRMEDKRSEEHIKLATEFGKTQLNMGHLVDAGRAQRGAGFEIRTDEHGVMRAGKGIFVSAEEQLKAQG
KVLDMDPALGQIHQANNEMQALSDAATQATALASDIQKQLSFVDNRLTQLQSAAILASAPMGVALTSGEH
LQLAARQNLMVNAGNNADVGVMKNLFIGAGEAMSMFVHKQDATLIANQGQVTIQAQNNVMSLTARQTLTI
TSSDDEIIITTPKKMTLNGGGSYLTLEASKIEHGSSGDMTIKCTNYLVPMVGAVLGYHVPSFSKVNLSLN
SPNDQSKPDEQNEQDSQNTGNPASE
 
Nucleotide Sequence: 2388 bp     [Download]
>gi|379703932|ref|NC_016835.1|:2739-5126 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGAGTACATCCGATGTTATCAACAGATTGCTCAATCAGTCCCGCTACCGTCTGGACGTTTCGCAAAGCC
CGGCCTTTCTCGACGTGTTGCGCTTCGAAGGGGAAGAGCAACTTAGCAAACCCTTTGAATACATTATTCA
TGTCACCAGCACGGCCACTGATTTAACCGCTGAACAGCTGGTTCTCAAACCGGCTACCTTTACCATGCAG
GCTCCTGTGTTTGATATTGCAGGCGTTGCGGAACCGGTCCGCGCTGTACATGGTGTTATTCAACATTTCT
CCCGTATCTCTACGTCAGCGGATCAGACGATTTACCGGCTGGTTTTGGTGCCGCGCGTGGCCTTACTGGA
CCACACTGCAAAGTGCGCACTTTATTTAAATCAGTCAGTACAGGAAGTGGTTGAAAAGGTTCTTCGTGCG
CACGGTCTGGAAGGCCCGGACTTCGAATTCCAGCTTTCCAGGTCATACCCGGCACGTGAGCTCATCACCC
AATGGCGGGAAACAGATTTAGCTTTCATCCAGCGTTTACTGGCGGAAGTCGGGATCTACTGGCATCTCGA
GATGGACACCCGCCTTGAGCATGACGTCATCATATTTGCTGACAGCCAGCAACAATATAAATTTGGAATC
CGTTTACCCTTACGCAATCAGGCGGGCATGAGCGACAGCGGTACCGAAAGCGTCTGGGGGCTGAGTACGA
AGCATCAGGTCGTCACGCAACAGGTTTCTACCCGTGATTACAACTACCGGGAAGCGTTGAGTCCGATGGA
CACCACTGCCAGTGCGGCAGGAAGTGATGAAACCACTATTGGCGAGGTTTACCAGTACGCGGAGCCTTTT
CTGCAATCCGGATCAGAAGACGGGGTAGAAACCGGTGCATTTTATGCCCGCCTGCGTCATGAACGCATTC
TGAATGCTCAGAAGAGCGTCACCGGTCACAGCAGTTGCCCGCATCTGGCACCGGGTCAGGTGCTGGAAGT
CGATGGCACACTTCCTGCTGTGTTAAATGAAGGCATCCTGCTGACGGGGATAAAAACCTACGGTTCGCGC
AAGAGTCGTTTTACCGCGCATCTGACCGGTCAGCCTTACAGTGAAACCGTCTGCTTCCGCCCTGCTCTGC
CGCAGCGCCCGGTTATCGCCGGTACCCTTCCTGCCCGGGTAGAAAGCACCACCAAAGGCGATATCTATTC
CTGGCTGGATAATCAGGGCAGATACCGCGTGAAACTCGATTTTGACCGCGACGAACAGGAACAGGGCTAC
GCCTATCTCTGGCTGCGGATGGCAAAACCTTATGCCGGTGATACCTACGGCTGGCACGCGCCTTTAATCG
ATGGCACTGAAGTCGCTATCGCTTTCGATTCCGGCGACTGTGACCGGCCTTATATCGCGTATGCCCTGCA
TGATTCAGCACACAGTGACCACGTCACCGACGATAACCATACGCGCAACGTTCTGCGCACTCCGTCTTTC
AACAAGCTGCGGATGGAAGACAAACGCTCAGAGGAACACATCAAGCTTGCCACCGAGTTTGGCAAAACGC
AGCTGAACATGGGGCATCTGGTGGATGCGGGACGCGCACAACGCGGTGCCGGCTTTGAAATCAGAACAGA
TGAACACGGCGTGATGCGTGCGGGAAAAGGAATATTTGTCAGTGCAGAAGAACAACTGAAGGCACAGGGA
AAAGTGCTGGATATGGATCCGGCCCTCGGTCAAATCCATCAGGCCAACAATGAGATGCAGGCTCTGAGTG
ACGCCGCCACACAGGCTACCGCGCTGGCATCAGATATTCAAAAGCAGCTCAGCTTTGTCGATAACCGTCT
GACGCAGTTGCAGTCCGCCGCCATTTTAGCCAGCGCCCCGATGGGTGTGGCTCTTACCAGCGGTGAACAT
TTACAGCTGGCAGCCAGACAGAACCTGATGGTGAACGCCGGTAACAATGCCGACGTCGGCGTCATGAAAA
ACCTGTTCATCGGTGCGGGAGAAGCGATGAGCATGTTTGTGCATAAACAGGATGCCACGCTGATTGCCAA
TCAGGGACAGGTCACTATCCAGGCGCAAAACAACGTCATGTCCCTGACTGCCAGACAAACCCTGACCATC
ACCAGCTCGGACGATGAAATCATCATCACTACCCCGAAAAAAATGACCCTCAACGGCGGCGGCTCTTACC
TGACGCTGGAGGCCAGCAAAATCGAGCACGGGTCTTCCGGGGATATGACAATTAAGTGCACGAACTACCT
GGTGCCGATGGTGGGGGCAGTATTGGGTTATCACGTACCCAGCTTTAGTAAGGTGAACTTGTCTCTGAAC
TCCCCGAACGATCAGAGCAAGCCGGATGAGCAGAATGAGCAGGACAGCCAGAATACCGGTAATCCTGCCT
CTGAATAA