SecReT6
Protein ID: 379703949
SecReT6 ID544
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4585
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]24602..26371 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDH2J168
KEGG IDraq:Rahaq2_4585
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.60E-184, Aligned region: 6..586
Protein Sequence: 589 a.a.     [Download]
>gi|379703949|ref|YP_005220323.1| type VI secretion protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MDDLTLRYYEAEMRYLREAGREFAHAHPDRAAMLNLDKSGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYMRTIPSLAIVELKPDYRQLKQVEIVPRGFSVLSQPVGQKHTCCQYQVTRDMPLMPIN
ISQAKLHTETDGRSTVRLRFDCGPLADWRKIDLSRVAIYLDADSPVSSALHLALTRKVQAMYIRQPELGQ
DRRAIDGWFKPMGFEENERLWPKGSSAFSGYQLLLEYFTFRPKFMFVELNGLQNVHLVPGTTWFELDIVL
SELWPYDLPFDTDTFRLHCVPVINLFSLEADPLQIDPLANEYLLRPLRMQDGHVEIYSVDQVHGSVKNGK
HDYVPFTSFRHRGGMMRHDAPERYFHTRVKRGPSGLHDTWLILGGKSFEAEQLAEQREALSLRITGTNGQ
LPRKALESTLLNRVVKAGKVPVQVRNLTTPTMPVYPPANDRFHWRVMSHLGSSFLSMMDNPEVLRGTLAL
YDWTDDEMNCRRLEAIVAVEHHLIQRFEKGFMLRGVDIEITLNTDNFAGEGDVNLFGEMLHRFFALYADI
HLFNQLTLVLQPTGKRLRWNENHSQHVPG
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|379703932|ref|NC_016835.1|:24602-26371 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGGATGATTTAACCCTGCGCTATTACGAAGCTGAGATGCGTTACCTGCGCGAGGCCGGGCGCGAATTTG
CCCATGCCCATCCCGACCGGGCCGCGATGCTCAACCTGGATAAGTCCGGGGCGCGCGATCCGTACGTTGA
ACGTTTATTTGAAGGTTTCGCATTTCTGATGGGGCGTCTGCGGGAGAAACTGGACGATGACCTGCCGGAA
CTCACCGAGGGACTGGTCAGCCTCTTGTGGCCACACTATATGCGGACAATCCCTTCACTGGCCATTGTTG
AATTGAAACCTGATTACCGGCAACTCAAGCAGGTGGAGATCGTGCCCCGGGGCTTCTCTGTCCTGTCACA
GCCTGTCGGGCAAAAACACACCTGCTGCCAGTATCAGGTGACGCGGGATATGCCACTTATGCCGATCAAT
ATTTCACAGGCGAAGTTGCATACTGAAACAGACGGGCGTTCAACCGTACGCCTGCGTTTTGACTGCGGTC
CGCTGGCGGACTGGCGAAAGATAGATTTAAGCCGCGTGGCAATCTATCTCGATGCCGACAGTCCGGTTAG
CAGCGCTCTGCATCTGGCCCTGACCCGCAAAGTTCAGGCCATGTATATCCGCCAGCCGGAGTTGGGTCAG
GATCGCCGTGCGATAGACGGCTGGTTCAAGCCCATGGGATTTGAAGAAAATGAACGCCTGTGGCCTAAAG
GAAGCTCAGCGTTCAGTGGCTATCAGTTGTTACTGGAATATTTTACCTTCCGCCCTAAATTTATGTTCGT
TGAGCTGAACGGACTGCAAAATGTCCATTTGGTACCGGGAACGACATGGTTCGAACTCGATATTGTCCTG
AGTGAGCTGTGGCCTTACGACCTGCCGTTTGATACCGATACCTTCCGGTTACACTGCGTTCCGGTCATTA
ACTTGTTTTCACTGGAAGCCGACCCGCTGCAAATTGATCCGCTGGCGAATGAATATCTTTTGCGGCCACT
GCGTATGCAGGATGGCCACGTAGAAATCTACAGTGTTGATCAGGTACACGGTTCCGTTAAAAACGGCAAA
CACGACTACGTGCCCTTCACCAGTTTCCGTCACCGCGGGGGCATGATGCGTCATGATGCCCCCGAACGCT
ATTTCCACACACGTGTTAAGCGCGGGCCTTCCGGCCTTCATGACACATGGTTAATTCTCGGCGGTAAATC
TTTTGAAGCAGAACAGCTTGCTGAACAACGCGAAGCACTTTCACTGCGTATTACCGGCACCAACGGCCAG
CTTCCACGTAAGGCACTGGAAAGTACCCTGCTCAACCGGGTTGTGAAAGCCGGCAAAGTCCCGGTACAGG
TTCGCAACCTCACCACGCCGACCATGCCGGTATACCCGCCTGCCAATGATCGCTTCCACTGGCGGGTGAT
GAGTCACCTGGGTTCAAGCTTCCTCAGCATGATGGATAACCCCGAAGTGCTGCGGGGCACGCTGGCGCTG
TATGACTGGACCGATGATGAAATGAACTGCCGCAGGCTCGAAGCGATTGTTGCCGTCGAACACCACCTGA
TCCAGCGATTTGAAAAAGGGTTCATGCTGCGCGGTGTCGATATTGAAATCACCCTGAATACAGACAACTT
CGCGGGTGAAGGGGACGTCAATCTCTTTGGTGAAATGCTGCACCGCTTCTTTGCCTTGTACGCCGATATT
CACCTTTTCAACCAGCTTACGCTGGTGTTGCAACCGACAGGAAAACGCCTGAGATGGAACGAGAATCACA
GCCAACACGTACCGGGCTGA