SecReT6
Protein ID: 379703950
SecReT6 ID544
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4586
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]26335..27417 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDH2J169
KEGG IDraq:Rahaq2_4586
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.30E-78, Aligned region: 21..321
Protein Sequence: 360 a.a.     [Download]
>gi|379703950|ref|YP_005220324.1| type VI secretion protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MERESQPTRTGLIDALSPRASYLNFYRFCQLLEQAGGDAPLLGTTSTPATDPIRFRPHPGMGFPVSEIRV
IEADREHVHATPTVRTTFMGLYGVDAPLPTGYLDDISQRREGYESVEHFLDIFNHRLMTQFYRIWRKYAY
PASFQAGGTDETSQCLLGLIGLGIPGTAKHIATPISRFLALLSTMRLPTRTAEGIRALVNLLAPLTQAYI
QGHDPVSVEMRSRSGFCAENRIALAQRSVLGRKGKDGNSRVLVSLMTSDPEEAEGWLPGGHLHTDLLVLM
RVYLGYRCNARLQLTVPTRLLPEPRLGGSRRIQLGRTGVLGLQESKRDSLPQSLTVSLGTYQGVHEEPLL
PAESGEYRFR
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|379703932|ref|NC_016835.1|:26335-27417 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGGAACGAGAATCACAGCCAACACGTACCGGGCTGATCGATGCCCTGAGTCCGCGGGCGTCCTACCTGA
ATTTTTACCGGTTTTGTCAGCTTCTGGAACAGGCTGGCGGGGATGCTCCGCTGCTCGGTACAACCAGCAC
TCCCGCAACAGATCCAATACGCTTTCGCCCGCATCCGGGCATGGGTTTTCCTGTCAGTGAAATACGCGTC
ATTGAAGCCGACCGGGAACATGTACACGCCACACCCACCGTTCGTACCACCTTTATGGGGCTCTATGGGG
TAGATGCCCCCTTACCCACAGGCTATCTCGACGATATCAGCCAACGGCGGGAAGGATACGAAAGCGTTGA
GCATTTTCTGGATATTTTCAACCACCGGCTGATGACGCAGTTCTATCGCATCTGGCGTAAATACGCCTAC
CCCGCTAGTTTCCAGGCTGGCGGAACGGATGAGACATCACAGTGCCTGCTCGGTCTGATTGGTCTGGGGA
TACCCGGCACGGCCAAACATATCGCGACGCCGATTTCCCGATTTCTTGCGCTTTTAAGCACTATGCGTTT
GCCGACACGAACGGCAGAAGGGATCCGTGCGCTGGTGAATCTGCTGGCACCCCTGACGCAGGCTTATATT
CAGGGGCATGACCCGGTGTCAGTGGAAATGCGCAGTCGTAGCGGGTTTTGCGCTGAAAACCGTATTGCGC
TGGCACAGCGCAGCGTACTGGGTCGCAAAGGAAAGGACGGTAATAGCCGGGTACTGGTGAGTCTGATGAC
CTCCGATCCTGAAGAAGCTGAAGGATGGTTACCCGGCGGCCATTTGCATACCGATTTACTCGTGCTGATG
CGGGTATATCTCGGCTACCGGTGCAATGCCCGTCTGCAACTCACCGTCCCTACCCGCTTGCTGCCGGAAC
CCCGGCTCGGCGGGTCCCGACGGATACAGCTCGGGCGCACCGGTGTACTGGGTTTACAGGAAAGCAAACG
TGACAGCCTGCCGCAAAGTCTGACCGTCAGCCTCGGCACCTATCAGGGTGTACATGAGGAACCCTTATTA
CCCGCTGAGTCGGGAGAATACCGGTTCCGTTAA