SecReT6
Protein ID: 379703951
SecReT6 ID544
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4587
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]27481..28023 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDH2J170
KEGG IDraq:Rahaq2_4587
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.80E-36, Aligned region: 20..171
Protein Sequence: 180 a.a.     [Download]
>gi|379703951|ref|YP_005220325.1| type VI secretion lipoprotein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MAKIIPSHTGWQYGSLFLLVVLLSGCGLTQKVVDGTKGVTKAIFYKQIKTLHLDFSPRTSMNTDEGDQSS
LATMVRVYQLKDRKAFDAADYEKLLLQSDDLLKADSLASKEVLVMPGGDVSLDMPMEPDAQFVAVVALFR
NPDRQHDTWRVVLKREEFDPDKPRTLELSNGQLTLLPLKD
 
Nucleotide Sequence: 543 bp     [Download]
>gi|379703932|ref|NC_016835.1|:27481-28023 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGGCAAAAATAATTCCCTCACATACAGGATGGCAGTATGGCAGCCTGTTTCTGCTCGTGGTTCTGCTTA
GCGGCTGTGGCCTGACTCAGAAAGTGGTCGATGGCACCAAAGGCGTGACCAAAGCGATTTTCTATAAGCA
AATTAAAACACTGCATCTCGATTTTTCCCCGCGCACTTCTATGAACACAGATGAAGGCGATCAGTCATCG
CTCGCCACCATGGTTCGTGTTTATCAGCTTAAAGATCGCAAAGCTTTTGACGCCGCGGATTATGAAAAGC
TGCTGCTTCAGTCCGACGACCTGTTAAAAGCCGATTCCCTGGCCTCTAAGGAAGTGCTGGTGATGCCGGG
CGGTGATGTATCACTGGATATGCCCATGGAACCCGATGCGCAGTTTGTCGCGGTGGTGGCGTTGTTTCGC
AACCCGGACCGACAACATGACACCTGGCGGGTGGTGCTGAAACGGGAAGAGTTTGATCCCGACAAGCCCC
GCACGCTGGAACTCAGTAACGGGCAGCTTACGTTGTTACCACTCAAAGATTAA