SecReT6
Protein ID: 379703952
SecReT6 ID544
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4588
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]28036..30391 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDH2J171
KEGG IDraq:Rahaq2_4588
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.10E-58, Aligned region: 37..345
T6SS_Vgr [PF13296], Evalue: 1.60E-33, Aligned region: 477..582
DUF2345 [PF10106], Evalue: 9.30E-32, Aligned region: 497..517
DUF2345 [PF10106], Evalue: 9.30E-32, Aligned region: 609..738
Phage_base_V [PF04717], Evalue: 4.80E-14, Aligned region: 390..472
Protein Sequence: 784 a.a.     [Download]
>gi|379703952|ref|YP_005220326.1| LOW QUALITY PROTEIN: Rhs element Vgr protein, partial [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MVDILKNLLPDAAGLSRYSLAIWNSPYALDVLNFRGEEQLSETFSYTVDVTCPEPDIDAAQMLRQFASFT
MGTPFQPERAVYGVIRDFQRLSTSADETLYRLELVPRLRLLENSTNSFIFQNQSVPEVVEFILRKHGLEG
QDFEFRLSHTYPDRELITQWGETDLQFIKRILAEVGIWFRFEADTRLTCEKVLFGDGPEQYRFGVTLPYC
EPSGMSDAHAESVWGLKIHWNAVTGKIFKRDYNYREATTPLDTSAQVRSAAPVTGESYLYARPYREAGGD
MDAAAETGAFYARIRHERQLNHQCRIFARTTGSGLAPGQVLEPQAYPFSDLPDGILITRIVAKGSRTDHF
RLNIWGMAYRETIGFRPEPPARPVLSGTIPARVESPAKGDTYAWLDNQGRYRVRIDGDRASADAGYAYLW
VRLAKPYGGDGYGWHMPLTDGTDVAIAFDGGDPDRPYIAAALHDSEHPDHVTERNHTRNVLRTPSNNTLR
MEDRRGEEHIRLATEYGKTQLNSGHIVDAQNAPRGQGFELRTDEHGALRGGKGVFLSADAQPQAQGQVPD
NRAAMAEIEYLQGQVKALSQAAAEAKALEADIAAQIAMFSERLKPINQVVLASAPQGMALTSGEHLQLQL
AAAKNMILNAGNNADIGVIKNLTVNTGEKMGLFALKGEMSLKASEGRVDVQAQNNRLALAAGKKVSITAV
DGDILFSAKKRITLIGGGSYLILQDGKIEYGTAGEYFRKTPHTVLTVANTMAAELAAMTGGGICLSCLMK
AAMSGNAFVIRGES
 
Nucleotide Sequence: 2356 bp     [Download]
>gi|379703932|ref|NC_016835.1|:28036-30391 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
GTGGTTGATATCCTGAAAAATCTTCTCCCTGATGCGGCAGGTTTGTCCCGCTACTCACTTGCTATCTGGA
ACAGCCCGTACGCTTTGGACGTGCTGAATTTTCGCGGCGAGGAACAGCTCAGCGAGACTTTTTCCTACAC
CGTTGACGTCACCTGCCCCGAACCGGATATCGATGCCGCACAGATGCTGCGCCAGTTCGCCAGCTTCACG
ATGGGCACGCCTTTCCAGCCTGAACGCGCCGTGTACGGCGTTATTCGTGACTTTCAGCGCCTCTCCACCT
CCGCCGATGAAACCCTGTACCGCCTCGAGCTGGTGCCGCGCCTGCGGCTGCTGGAAAACAGCACCAACAG
CTTTATTTTTCAGAACCAGTCGGTGCCTGAAGTGGTGGAATTTATTCTGCGCAAACACGGGCTGGAGGGG
CAGGATTTTGAGTTTCGCCTCAGCCACACCTACCCCGACCGCGAGCTTATCACCCAGTGGGGCGAGACCG
ACCTGCAGTTTATCAAACGTATTCTGGCCGAGGTCGGTATCTGGTTCCGCTTTGAGGCGGACACCCGCCT
GACGTGTGAGAAAGTGCTGTTCGGCGACGGGCCGGAGCAGTACCGGTTTGGCGTCACCCTGCCGTACTGC
GAGCCGTCGGGGATGAGCGACGCCCACGCCGAAAGCGTCTGGGGACTGAAAATCCACTGGAACGCCGTGA
CCGGCAAAATCTTCAAACGCGATTACAACTACCGCGAGGCGACCACGCCGCTCGATACCAGCGCGCAGGT
GCGCAGCGCCGCGCCGGTGACCGGCGAAAGCTACCTGTACGCCCGACCCTACCGCGAGGCCGGTGGAGAC
ATGGACGCCGCCGCCGAAACCGGCGCGTTCTACGCCCGCATCCGCCATGAACGTCAGCTGAATCACCAGT
GCCGCATTTTTGCCCGCACCACCGGCAGCGGACTGGCGCCGGGTCAGGTGCTGGAACCGCAGGCCTACCC
GTTCAGCGACCTGCCGGACGGCATCCTGATTACCCGCATCGTCGCCAAAGGCTCGCGCACCGACCACTTC
CGCCTCAATATCTGGGGCATGGCCTACCGCGAAACGATTGGCTTTCGCCCCGAACCGCCGGCGCGGCCGG
TGCTCAGCGGCACGATACCGGCGCGGGTGGAAAGCCCGGCCAAAGGCGACACCTATGCGTGGCTGGATAA
TCAGGGGCGTTACCGCGTACGGATTGACGGCGACCGCGCCTCGGCCGATGCCGGTTATGCGTACCTGTGG
GTGCGCCTCGCCAAACCCTACGGCGGTGACGGCTACGGCTGGCATATGCCGCTGACCGACGGCACCGACG
TGGCCATCGCCTTTGACGGCGGCGACCCCGACCGGCCGTATATCGCCGCCGCGCTGCACGACTCTGAACA
TCCTGACCACGTGACGGAAAGGAACCACACCCGTAACGTCCTGCGCACCCCGTCAAATAACACGCTGCGG
ATGGAGGACCGGCGCGGTGAGGAGCACATCAGGCTCGCCACCGAATACGGCAAAACCCAGCTGAATAGCG
GGCATATCGTCGATGCGCAAAACGCGCCGCGCGGGCAAGGTTTTGAGCTGCGCACCGACGAACACGGCGC
CCTGCGCGGCGGTAAGGGCGTCTTTCTCAGCGCGGACGCCCAGCCGCAGGCGCAGGGCCAGGTGCCGGAT
AACCGCGCGGCGATGGCTGAAATCGAATACCTGCAGGGTCAGGTGAAAGCCCTCAGCCAGGCCGCCGCGG
AGGCCAAAGCGCTGGAGGCCGACATCGCGGCGCAAATCGCCATGTTCAGCGAACGGCTGAAGCCGATAAA
TCAGGTGGTGCTGGCCAGCGCGCCACAAGGCATGGCGCTGACCAGCGGCGAGCATCTGCAACTGCAACTG
GCAGCCGCCAAAAACATGATACTGAACGCCGGTAACAATGCGGATATCGGGGTGATTAAGAACCTGACCG
TCAACACCGGTGAGAAAATGGGCCTCTTTGCGCTGAAGGGTGAGATGAGCCTGAAGGCCAGCGAAGGCAG
GGTCGACGTTCAGGCGCAGAACAACCGGCTGGCGCTTGCGGCGGGCAAAAAAGTGAGCATCACGGCGGTG
GACGGCGACATCCTGTTCAGCGCGAAAAAGCGCATCACGCTGATTGGCGGCGGCAGCTACCTCATCCTGC
AGGACGGCAAAATCGAGTACGGCACGGCGGGTGAGTATTTCAGGAAAACGCCGCACACGGTGCTGACGGT
GGCGAATACCATGGCGGCAGAACTGGCCGCCATGACCGGTGGCGGAATTTGCCTCAGTTGCCTGATGAAA
GCGGCAATGTCGGGCAATGCATTTGTTATAAGGGGAGAATCATGA