SecReT6
Protein ID: 379703957
SecReT6 ID544
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4595
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]33642..35246 [+]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDH2J176
KEGG IDraq:Rahaq2_4595
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-21, Aligned region: 67..127
ImpA-rel_N [PF06812], Evalue: 1.30E-21, Aligned region: 157..183
ImpA-rel_N [PF06812], Evalue: 1.30E-21, Aligned region: 242..261
Protein Sequence: 534 a.a.     [Download]
>gi|379703957|ref|YP_005220331.1| type VI secretion-associated protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MATLHTLLALCPQENPDILMQKAKVQTALWEKWLNPVSSDNATGEDPGYDDDFQRMREEVNKLSGADTEL
VCQLAEKLLTTVCKDVRVATYYLWARLHRDGESGLAEGLELLSGLVSRYGDQLLPSRKNSRRAAMEWLAG
SKVLDSLSLYPEVDKPKFERILAALTLFEDVITSWEDVNRPQLGGLYDALESRLAQSGGFDAVVPQNSGG
QATSDSRSLSPDMPTLKVIQSGRELLDQAKALAQYLRDQPQGWLSGHRLMTTIRWDTVDQLPPLDAKGCT
RLAPPRTEYRAQLKRLYLQQSWTELLENADRMFTEGVNHFWLDIQWYLHQALSKSGAPYDSWAEFIEQDL
RLLLLRLPGLETLAYSDGTPFADEVTAGWITRDIQDNDGRWQSEPNAVSASGDEDVLQLETEALAQADSE
GIEAALNWLQIRPGITTPRQRWLIRLLMARVAEQYGKNEMALHLLGELDSTGNRLTLKQWEPALLFEVKA
RRLKLLRMQFQRGDTDKAKLTLEMDKLLAGLVSIDPARAAVLCA
 
Nucleotide Sequence: 1605 bp     [Download]
>gi|379703932|ref|NC_016835.1|:33642-35246 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGGCCACATTACACACCCTGTTAGCGCTATGCCCACAGGAAAACCCAGATATATTGATGCAAAAGGCCA
AAGTGCAAACAGCACTGTGGGAAAAATGGCTAAACCCGGTTAGCAGCGATAACGCAACTGGTGAAGATCC
CGGTTATGACGATGACTTTCAACGTATGCGTGAAGAAGTTAATAAGCTTTCAGGCGCGGATACTGAACTG
GTGTGCCAACTGGCGGAGAAATTACTGACCACTGTATGCAAAGACGTAAGGGTAGCCACTTATTATCTCT
GGGCACGATTGCATCGCGACGGCGAATCGGGTCTGGCCGAAGGGCTGGAACTGTTGAGCGGACTGGTCTC
ACGCTATGGCGACCAGTTGTTGCCATCACGAAAAAATAGCCGGCGGGCTGCCATGGAGTGGCTGGCAGGC
AGTAAAGTTCTCGACAGCCTGTCGCTGTATCCCGAAGTCGATAAGCCAAAATTTGAACGCATTTTGGCTG
CACTCACACTGTTTGAAGACGTTATTACATCATGGGAGGACGTAAACCGACCACAGTTGGGCGGACTTTA
TGATGCCCTAGAATCCCGACTGGCTCAGTCTGGTGGCTTCGATGCCGTTGTTCCGCAAAACAGCGGCGGT
CAGGCGACGTCTGATTCGCGCTCCTTATCGCCGGACATGCCGACATTAAAGGTAATACAGTCTGGTCGTG
AGTTACTCGATCAGGCTAAGGCGTTAGCTCAGTACCTGCGAGACCAGCCACAAGGCTGGTTATCAGGGCA
CAGGTTGATGACTACGATACGCTGGGACACTGTCGACCAACTGCCTCCGCTGGATGCCAAGGGTTGTACT
CGCTTGGCCCCCCCAAGAACTGAATATCGTGCCCAACTCAAGCGCCTGTATTTGCAACAAAGCTGGACCG
AATTATTGGAAAACGCCGATCGAATGTTTACCGAAGGCGTGAATCATTTCTGGCTGGATATCCAGTGGTA
TTTGCACCAGGCGCTCAGCAAGTCGGGGGCTCCTTATGATAGCTGGGCAGAATTCATCGAGCAGGATCTG
CGTTTATTGTTGCTTCGTTTACCGGGACTGGAAACGCTCGCCTACAGTGACGGTACCCCCTTTGCCGACG
AAGTGACCGCAGGCTGGATCACACGTGATATTCAGGACAATGACGGACGATGGCAATCTGAACCCAATGC
AGTCTCTGCAAGTGGCGATGAAGATGTCCTTCAGCTTGAAACCGAAGCACTGGCGCAGGCAGACAGTGAA
GGTATAGAAGCTGCACTCAATTGGTTGCAGATTCGCCCGGGGATCACTACACCTCGCCAACGTTGGCTAA
TACGGCTGCTCATGGCTCGTGTTGCTGAACAATATGGAAAAAATGAAATGGCACTCCACTTACTTGGAGA
ACTGGACAGCACAGGAAATCGCCTGACGCTGAAACAATGGGAGCCTGCCCTGCTGTTTGAAGTAAAAGCA
CGACGACTCAAACTGCTGAGAATGCAATTCCAGCGCGGCGATACTGATAAAGCCAAACTCACACTTGAAA
TGGACAAACTGCTCGCCGGATTGGTTTCTATTGATCCTGCACGCGCGGCTGTTCTGTGTGCTTAA