SecReT6
Protein ID: 379703958
SecReT6 ID544
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4596
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]35265..35696 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDH2J177
KEGG IDraq:Rahaq2_4596
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-15, Aligned region: 29..115
Protein Sequence: 143 a.a.     [Download]
>gi|379703958|ref|YP_005220332.1| type VI secretion system lysozyme-like protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MNSKSPSLYEILTGNFAGGLDLHNVSEENQVILSVLDNMQRILNCRAGTLSHLPDYGLPDMSKILQGMPG
TAHSLLDVLSETLLKYEPRIKKLHVILLPQSSPGHLEYAIDAELKELGLVRFGTEFMPEGRVLMRHMKQQ
NYV
 
Nucleotide Sequence: 432 bp     [Download]
>gi|379703932|ref|NC_016835.1|:35265-35696 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGAACTCAAAATCCCCTTCTCTGTATGAAATCCTCACTGGCAATTTTGCCGGCGGCCTCGATCTGCACA
ACGTCAGCGAAGAGAATCAGGTGATCCTCTCCGTGCTCGACAACATGCAGCGTATTCTCAACTGTCGTGC
CGGCACGCTCAGCCATCTGCCGGATTACGGCCTGCCGGACATGAGCAAAATCCTGCAGGGGATGCCCGGT
ACGGCACATTCACTGCTGGATGTCTTGTCAGAAACCCTGCTGAAATACGAGCCGCGCATCAAAAAGTTGC
ACGTTATTTTATTGCCCCAGTCCAGCCCCGGACATCTTGAATATGCCATTGACGCCGAGCTGAAAGAGCT
TGGCTTAGTGCGATTCGGTACCGAATTTATGCCGGAAGGCCGCGTACTGATGCGCCATATGAAACAGCAG
AATTACGTGTGA