SecReT6
Protein ID: 379703960
SecReT6 ID544
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4598
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]36749..38146 [+]
Producthypothetical protein
NoteTssA
UniProt IDH2J179
KEGG IDraq:Rahaq2_4598
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 5.50E-47, Aligned region: 54..74
DUF3702 [PF12486], Evalue: 5.50E-47, Aligned region: 111..153
DUF3702 [PF12486], Evalue: 5.50E-47, Aligned region: 190..204
DUF3702 [PF12486], Evalue: 5.50E-47, Aligned region: 304..451
ImpA-rel_N [PF06812], Evalue: 1.30E-21, Aligned region: 41..101
Protein Sequence: 465 a.a.     [Download]
>gi|379703960|ref|YP_005220334.1| hypothetical protein Rahaq2_4598 [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MMAQDINRQLRTGGDPRALADYAVLREELSKLTHPARPDVDWKKVEQLCLNLFQQNGIELQTASWYTQAR
TRLTGMSGLNEGLAILEALISRQWPGLWPQPVHARMEILSGLSQRLQQTLRSMTLDYHDLSQIYQAEKLI
NALCEVLQRLELKHVSQLEALSSFMHGAAVRLENMHAASDTTIVLPAAATENTEKRWATQAREQWVYVAQ
AEPAEPQVTITPPAPVKHPVQWKGFIAGIMATLLAGGGVCAAITAFYHPPSGEQLMATLPVMPKPLNAQT
LETLKNRQAEMLHREAPAYLAAMQQQTRQLATLSPRWAQDTGSHLVSQALILWPDNPATAALAKSWTQQL
NANAVPLENLSGWQQANTQLQQLADKLNGLDEQRGKYMTVSQLKSSVFAIQQALNGSPPVEESLRKLAQD
KQQNKDVSPQLMMQLDNQFTQLLNRYVLLTQTLPATAGKNGQADN
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|379703932|ref|NC_016835.1|:36749-38146 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGATGGCCCAAGACATAAACCGCCAGCTACGCACCGGGGGTGACCCGCGTGCGCTGGCTGATTACGCCG
TTTTACGCGAAGAACTGAGCAAATTAACCCATCCGGCGCGTCCGGATGTGGACTGGAAAAAGGTGGAACA
ACTGTGTCTGAACCTGTTTCAGCAGAACGGTATCGAACTGCAAACGGCGTCGTGGTACACACAGGCCAGA
ACGCGGTTAACGGGTATGTCAGGATTAAATGAAGGGCTGGCGATCCTCGAGGCATTGATTTCACGGCAGT
GGCCGGGACTGTGGCCGCAGCCGGTGCATGCGCGGATGGAAATACTCTCCGGCCTGAGCCAGCGTCTGCA
ACAGACATTGCGCAGCATGACCCTGGATTATCACGATCTGTCGCAGATCTATCAGGCCGAAAAACTGATC
AATGCGCTGTGCGAGGTCTTGCAGCGTCTGGAGCTGAAGCATGTCAGCCAACTGGAAGCACTGAGCAGTT
TTATGCACGGTGCTGCCGTGAGGCTGGAAAATATGCACGCGGCCAGCGATACGACAATCGTATTACCTGC
GGCGGCAACAGAGAACACGGAAAAAAGATGGGCTACGCAAGCCCGCGAGCAGTGGGTGTATGTTGCACAG
GCTGAGCCTGCCGAACCACAGGTGACGATTACGCCACCCGCGCCGGTGAAGCATCCGGTGCAATGGAAAG
GGTTTATCGCCGGAATCATGGCAACGTTGCTGGCTGGCGGCGGAGTCTGCGCAGCTATCACGGCGTTTTA
TCATCCGCCCTCCGGTGAACAACTGATGGCGACGCTGCCGGTAATGCCAAAACCGCTGAATGCCCAGACA
CTGGAAACGCTGAAGAACCGGCAGGCTGAGATGCTGCACCGTGAGGCACCGGCGTATCTGGCCGCCATGC
AGCAGCAAACGCGCCAGCTCGCCACCTTGTCGCCGCGCTGGGCGCAGGATACCGGGTCACATCTGGTCAG
TCAGGCACTGATACTGTGGCCTGATAATCCGGCGACCGCTGCGCTGGCGAAAAGCTGGACGCAGCAACTG
AACGCCAATGCCGTGCCTTTGGAAAACCTCAGCGGCTGGCAACAGGCCAATACTCAGCTGCAACAACTGG
CGGACAAACTCAACGGGCTGGATGAGCAGCGCGGTAAATATATGACTGTCTCGCAGCTAAAATCCTCCGT
TTTTGCCATCCAGCAGGCGCTCAACGGTTCACCGCCGGTAGAAGAATCGCTGCGTAAACTGGCGCAGGAC
AAACAGCAAAATAAGGATGTTTCACCGCAGTTGATGATGCAACTGGATAATCAGTTCACGCAGCTGCTGA
ACCGGTATGTGTTGCTTACTCAAACCTTACCGGCGACCGCCGGTAAAAATGGTCAGGCAGATAACTGA