SecReT6
Protein ID: 379704123
SecReT6 ID545
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4766
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]205434..206525 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDH2J1P2
KEGG IDraq:Rahaq2_4766
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-73, Aligned region: 41..334
Protein Sequence: 363 a.a.     [Download]
>gi|379704123|ref|YP_005220497.1| type VI secretion protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MAGTPPDAGVVLMMPDDFDDDAKKKENVLKEFWRDKDGNDRAYAFNFYRFCQLLEKQLSDNKPIGSTFSP
KNDAVRFRPHPGMGFPVSELKAVETREECPDTPPTVRATFMGLYGVDSPLPTGYIDDIAQRREGHEALEA
FLDIFNHRMMTQFYRIWRKYNYPATFEDGGTDKTSRSLMALTGITGSGDVPASRLLALLQPLVRTTRTAE
GIVSVIRSQAPNTQVTVKPHKVTRMAAGKRARFSFSEQQRLSDHLVLGSHTEDANYCIGVEMFTEDAAEA
KGWLPGGQLREDVFTLLRVYLGCDYDASLTLTIPMKLAPLPRLGDPRLMAGYNVVMGLREDNLDKMPKEV
TMKLGRIRNERRC
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|379703932|ref|NC_016835.1|:c206525-205434 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGGCCGGAACGCCGCCTGACGCGGGTGTTGTTCTGATGATGCCAGATGATTTTGATGACGATGCAAAAA
AGAAAGAGAACGTCCTGAAGGAATTCTGGCGGGACAAGGACGGTAACGACCGGGCGTACGCGTTTAACTT
CTACCGTTTCTGCCAGCTGCTGGAGAAACAACTCTCGGATAACAAACCGATCGGCAGCACCTTCTCGCCG
AAAAACGATGCGGTGCGCTTTCGTCCGCATCCGGGGATGGGTTTTCCGGTCAGCGAACTTAAAGCCGTCG
AAACGCGCGAAGAATGCCCTGATACACCGCCGACGGTGCGCGCCACCTTCATGGGATTATACGGCGTGGA
CTCGCCGCTGCCGACCGGTTACATCGATGATATTGCTCAGCGACGCGAAGGTCACGAGGCGCTGGAAGCC
TTTTTAGACATCTTCAACCACCGGATGATGACGCAGTTTTACCGCATCTGGCGAAAGTACAATTATCCCG
CCACCTTTGAGGACGGCGGTACCGACAAAACGTCGCGCAGCCTGATGGCCCTGACCGGTATCACCGGCAG
TGGCGACGTACCCGCCTCGCGATTGCTGGCGTTACTGCAGCCGCTGGTCAGAACCACCCGCACGGCGGAG
GGGATTGTCAGTGTGATCCGCTCACAGGCGCCCAACACGCAGGTCACCGTAAAACCGCATAAGGTCACGC
GAATGGCCGCCGGCAAACGAGCGAGATTCTCTTTTTCAGAACAACAAAGGTTGAGCGATCATCTGGTTCT
TGGCAGTCATACGGAGGATGCTAACTACTGCATCGGTGTAGAAATGTTTACCGAAGACGCGGCAGAGGCC
AAAGGCTGGCTGCCCGGCGGTCAGTTGCGTGAAGACGTGTTTACCCTGCTGCGCGTCTATCTGGGGTGTG
ATTACGATGCCAGCCTGACGCTGACGATTCCGATGAAGCTCGCACCGCTGCCGCGCCTGGGCGATCCCAG
GCTAATGGCGGGCTACAACGTGGTGATGGGGTTGCGGGAAGATAATCTGGATAAAATGCCGAAAGAGGTG
ACGATGAAACTGGGCAGGATCCGGAATGAAAGAAGATGTTAA