SecReT6
Protein ID: 379704124
SecReT6 ID545
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4767
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]206489..208264 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDH2J1P3
KEGG IDraq:Rahaq2_4767
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.90E-119, Aligned region: 5..588
Protein Sequence: 591 a.a.     [Download]
>gi|379704124|ref|YP_005220498.1| type VI secretion protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MEDDFLKYFDGEMRYLKEAGLEFAKEFPELGRALGLDGSPVPRDDSVERLFQGFSLMMAKLRQKIDDDIP
ELTEPLLSHLLPVINRTLPSTAIVELTPAAPALHIREEILPAESELLTRPPGNDNQRCAYRTTRDLKVHP
FALDNVSLFTLQEGQQALKLRFTLPALTEIRRADWQNISLYLNGDRVLQSALYLALSRQIKRVNVRFWQE
STVLTPVDVQFVPRWQAENDASIWPESDSPALCGEVRPWLEYFTSPERYFFMQLRGLETLTFPADTTAFD
IEVTLSERWPYDLAVPPDAIRMHCVPVINLFRLLAQPLSVTAAVSDYRLRPHRLSDGRTEIYAVNDVAEV
TEDNTEFSYVPYSQFREKGGMLQYAKNWPDRYYHTRMYRGTSGLNETILMLGGRTHEAQNGLKMRLNMTC
TNGAWPRMALQESVFDGETALGNLELKCATRKRPSMPYYPPAAELYQWQVLSLLHPQAIAGLMEIGTLRH
ALSLLDWTHDPENARRIAGITHVEYAPSHYPAEGWHGVAIRVTLDEHQFCGLGDALLFCEVLEQFYTQYA
DIRRFIQLTVTLSQSGTQWAWPERRLTRVLF
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|379703932|ref|NC_016835.1|:c208264-206489 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGGAAGACGATTTCTTAAAATATTTTGACGGCGAAATGCGCTACCTGAAGGAAGCCGGGCTGGAGTTTG
CGAAAGAATTCCCGGAACTGGGGCGTGCACTGGGATTAGATGGCAGTCCGGTACCGCGCGATGACTCCGT
CGAACGGCTGTTTCAGGGCTTTTCGCTGATGATGGCCAAGCTGCGTCAGAAGATAGATGACGATATTCCC
GAGCTGACCGAGCCGCTGCTCTCGCACCTGCTGCCGGTGATCAACCGCACCCTGCCTTCCACCGCGATTG
TCGAACTGACACCGGCGGCGCCTGCGCTGCACATCCGCGAGGAAATATTACCGGCAGAAAGCGAACTGTT
AACCCGGCCGCCGGGCAATGACAACCAGCGCTGTGCCTACCGCACGACCCGCGACCTGAAGGTGCATCCG
TTTGCCCTCGATAACGTCTCGTTATTCACCCTGCAGGAAGGCCAGCAGGCGCTGAAACTGCGCTTTACCC
TGCCCGCCCTCACTGAAATCCGCCGCGCCGACTGGCAGAACATCAGCCTGTATCTCAACGGCGACCGCGT
GCTGCAGTCTGCGCTGTATCTGGCTCTCAGCCGTCAGATAAAGCGGGTAAACGTGCGGTTCTGGCAGGAA
TCGACAGTGCTGACGCCGGTGGACGTGCAGTTTGTGCCGCGCTGGCAGGCAGAAAACGACGCCTCAATCT
GGCCGGAAAGCGACAGCCCGGCACTCTGCGGCGAGGTGCGCCCGTGGCTGGAGTATTTCACTTCCCCCGA
ACGCTATTTCTTTATGCAGCTGCGCGGGCTGGAGACCCTGACCTTCCCGGCCGACACCACCGCCTTTGAT
ATCGAGGTGACGCTCAGCGAGCGCTGGCCATACGATCTGGCCGTGCCGCCGGATGCCATCCGCATGCACT
GCGTGCCGGTGATCAACCTGTTCCGCCTGCTGGCCCAGCCGCTGTCCGTGACCGCCGCGGTCAGCGATTA
CCGCCTGCGTCCGCACCGGCTCAGCGACGGCCGCACTGAAATCTATGCGGTTAATGATGTCGCGGAAGTG
ACCGAGGACAACACTGAGTTCAGCTACGTGCCCTACAGCCAGTTCCGTGAGAAAGGCGGCATGCTCCAGT
ATGCAAAAAACTGGCCTGACCGTTATTACCACACCCGCATGTACCGGGGAACGTCCGGGCTGAACGAGAC
CATTTTAATGCTCGGGGGACGCACCCACGAGGCGCAGAACGGCCTGAAAATGCGCCTGAACATGACCTGC
ACCAACGGTGCCTGGCCGCGCATGGCGTTGCAGGAGAGCGTCTTCGACGGCGAAACTGCGCTGGGTAATC
TTGAGCTGAAGTGTGCGACCCGCAAGCGTCCCTCGATGCCGTATTACCCGCCTGCCGCTGAACTTTATCA
GTGGCAGGTGTTATCGCTGCTGCATCCGCAGGCCATCGCCGGTCTGATGGAGATCGGCACGCTGCGTCAC
GCGCTCAGCCTGCTGGACTGGACGCATGACCCGGAAAACGCGCGCCGCATTGCAGGCATCACGCATGTTG
AATACGCACCGTCGCACTACCCCGCTGAAGGCTGGCACGGCGTGGCCATCCGCGTAACCCTGGATGAACA
TCAGTTCTGTGGTCTGGGTGACGCCCTGCTGTTTTGCGAGGTTCTGGAGCAGTTCTACACCCAGTACGCC
GATATCCGCCGGTTCATTCAGCTGACGGTGACACTCAGCCAGTCCGGGACACAATGGGCATGGCCGGAAC
GCCGCCTGACGCGGGTGTTGTTCTGA