SecReT6
Protein ID: 379704125
SecReT6 ID545
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4768
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]208264..208797 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDH2J1P4
KEGG IDraq:Rahaq2_4768
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.30E-37, Aligned region: 20..170
Protein Sequence: 177 a.a.     [Download]
>gi|379704125|ref|YP_005220499.1| type VI secretion lipoprotein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MTPDNFQRVRRGTVLFLLPLLISSCGLTQRVGNGASAVADAVLYRKIDTLHLKLTSRAALNSNEGGEALP
TVVRVYQLKDRKTFDTASYAALLRQDNTVLAADLLDRQVVQVMPDAEATVAVPLHADAQFVAVVALFMAP
DVTNNTWRLVLERSDLDDSKDQIVELNDNRLQLRKSQ
 
Nucleotide Sequence: 534 bp     [Download]
>gi|379703932|ref|NC_016835.1|:c208797-208264 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGACGCCCGATAATTTCCAGCGAGTAAGACGCGGCACCGTGCTGTTTTTACTGCCCTTACTGATTAGCA
GCTGCGGCCTGACGCAGCGCGTGGGCAACGGCGCTTCTGCGGTCGCCGATGCCGTGCTCTACCGTAAAAT
AGACACCCTGCATCTGAAGCTGACCTCCCGCGCCGCGCTCAACAGCAACGAAGGCGGCGAGGCGCTGCCG
ACGGTGGTTCGCGTTTATCAGCTCAAAGACCGTAAAACCTTCGATACGGCCAGCTACGCCGCCCTGCTCA
GGCAGGACAACACCGTGCTGGCCGCTGACCTGCTCGACCGGCAGGTTGTCCAGGTAATGCCGGACGCAGA
GGCGACGGTGGCCGTGCCGCTGCATGCCGACGCACAGTTTGTCGCCGTGGTGGCCCTCTTTATGGCACCG
GATGTCACAAACAACACCTGGCGGCTGGTTCTCGAACGCAGCGACCTCGATGACAGTAAAGACCAGATCG
TTGAGCTCAATGACAACCGGCTGCAACTGAGGAAAAGTCAGTAA