SecReT6
Protein ID: 379704132
SecReT6 ID545
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_4775
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]217499..220009 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDH2J1Q1
KEGG IDraq:Rahaq2_4775
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 5.10E-44, Aligned region: 613..761
Phage_GPD [PF05954], Evalue: 7.60E-42, Aligned region: 44..352
T6SS_Vgr [PF13296], Evalue: 4.30E-33, Aligned region: 491..596
Phage_base_V [PF04717], Evalue: 4.30E-12, Aligned region: 410..484
Sarcoglycan_1 [PF04790], Evalue: 0.0018, Aligned region: 684..722
Sarcoglycan_1 [PF04790], Evalue: 0.0018, Aligned region: 786..807
Protein Sequence: 836 a.a.     [Download]
>gi|379704132|ref|YP_005220506.1| Rhs element Vgr protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MGIQEYILAGSKLPVHNHYQLRLTRLESQQPGVDISVLRFSGSEAISDILRYEIEFTSAVKDIPAQHIIN
YSALFLMYPDGKPWKSVKPRIIPGVITRFRQCGTSADETRYVATLEHRVTRLNQGSNNAIYQNDSVISMT
ENTFLRYNMDRLDFRFALHDRYPLKKFMMQFGESEYAHIARRLADSGISYFFEYDEENNCDVMVLADHSY
AWPEPVAIPFRNPAGMFDGGLESVWEMSVSRKAIPKSVTVNDDYYPAAQSDMTATATTNPDYPALVAEDY
RWGEYYPEPGKEYSSDPGQGMWYAKRRQERYLSEQITFEGKSNCMTLRPGMVITTPGKDWPEAPDGLLIV
STNSKNVARDTAYFVTFTAVPRNTQHPYRPALLPWPTVTGTLPARISSAHPDEPYAHINADGLYRAQFGF
DRTEWQKGFESCWLRLAKPYSGDTCGFHMPLLDSTGVAIAFENGDVDRPYIAYALHDSRHPDHVALPNYK
RNIIRTPSGNKIRLEDQRGKEHIKISTVHSGKSQLSLGHLVDSARKQRGEGAELRTDAYVAVRGGKGVLL
STEPKNSAQGQQLDMDAAIAQLEKALALAKTLKSTADIAQASPAETTDQELLKTDLTKLAQPGVVVYGDA
GIAHTTPKTIQQTAGKNLVATAGQDASFSVFRRFSVAAGELFSVFANKLGIKLIAAAGKVQLQAQKDQME
LTSFEDMQITSTNGRIVLNAKKELLLMCGGAGIRIKDGTIEELAPTRITQKSPVLEYQGGDSVKQAMPTF
NQGDFGMKYKLHINGDPSHVLKNQKFRVHRQDGSVSEGITDANGESSLLQMSELENVAIELIKGVK
 
Nucleotide Sequence: 2511 bp     [Download]
>gi|379703932|ref|NC_016835.1|:c220009-217499 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGGGCATTCAGGAATACATTCTTGCAGGCAGTAAATTACCGGTCCACAACCATTACCAGTTAAGACTTA
CACGACTTGAATCTCAGCAACCCGGCGTCGATATTTCGGTGCTCAGGTTCAGCGGCAGCGAGGCCATCAG
CGATATTCTGCGCTATGAGATTGAGTTCACCAGCGCGGTGAAAGACATTCCCGCTCAGCACATCATCAAT
TATTCCGCCCTGTTCCTGATGTATCCCGACGGCAAGCCGTGGAAATCCGTTAAACCGCGCATTATCCCCG
GTGTCATTACCCGGTTCCGCCAGTGCGGCACTTCCGCCGATGAGACCCGTTACGTCGCCACGCTGGAACA
CCGCGTCACGCGGTTAAATCAGGGCAGCAATAACGCGATTTACCAGAACGACAGCGTCATCAGCATGACC
GAGAACACCTTCCTGCGTTACAACATGGACCGGCTGGATTTTCGGTTTGCGCTGCATGACCGGTATCCGC
TGAAAAAATTTATGATGCAGTTCGGCGAAAGTGAATACGCCCATATTGCACGACGCCTGGCCGACAGCGG
TATCTCGTACTTCTTTGAATACGATGAAGAAAACAACTGCGACGTTATGGTGCTCGCCGACCATTCTTAC
GCCTGGCCGGAACCGGTCGCCATCCCGTTCCGTAACCCGGCGGGCATGTTCGACGGCGGCCTGGAATCGG
TCTGGGAGATGTCAGTCAGCCGCAAAGCCATCCCGAAATCGGTGACGGTTAACGACGATTACTACCCCGC
AGCACAAAGCGATATGACCGCCACGGCGACCACCAATCCGGATTATCCAGCGCTGGTTGCCGAAGATTAC
CGCTGGGGTGAGTACTATCCTGAGCCGGGCAAGGAATACAGCAGCGATCCCGGACAGGGCATGTGGTACG
CCAAACGCCGTCAGGAACGTTACCTTAGTGAGCAAATCACCTTTGAGGGCAAATCCAACTGCATGACGCT
GCGTCCGGGGATGGTCATCACCACGCCCGGCAAAGACTGGCCTGAGGCGCCGGATGGCCTGCTGATTGTC
TCCACAAACTCTAAAAACGTCGCCCGCGACACGGCGTATTTCGTCACCTTCACTGCCGTTCCCCGTAATA
CACAGCATCCGTACCGCCCTGCGTTGTTGCCGTGGCCAACTGTCACCGGCACGCTGCCTGCCCGTATCTC
CAGCGCGCATCCGGATGAACCTTACGCGCACATCAACGCCGACGGTTTGTACCGTGCGCAGTTTGGCTTC
GACCGCACCGAATGGCAGAAAGGCTTTGAGAGCTGCTGGTTGCGTCTGGCCAAACCGTATTCCGGTGATA
CCTGCGGCTTCCATATGCCGCTGCTGGATTCCACCGGCGTGGCGATTGCCTTCGAGAACGGTGACGTTGA
CCGGCCTTATATTGCTTATGCGCTGCACGATTCACGACATCCGGATCATGTGGCGCTGCCTAATTACAAG
CGGAACATCATCCGCACTCCTTCTGGAAATAAGATTCGACTTGAGGACCAACGGGGCAAAGAACATATAA
AAATCAGCACGGTACATTCAGGTAAGAGCCAGCTCAGTCTGGGACACCTGGTGGACAGTGCCAGAAAGCA
GCGAGGTGAAGGCGCAGAATTGCGAACTGATGCCTATGTTGCCGTTCGCGGCGGGAAAGGCGTGCTGCTA
TCTACCGAGCCGAAGAACAGTGCTCAGGGACAGCAACTGGATATGGATGCCGCCATTGCCCAGCTTGAAA
AAGCCCTGGCTCTGGCCAAAACCCTGAAGAGTACCGCCGATATCGCTCAGGCGTCTCCGGCAGAAACCAC
CGATCAGGAGTTGCTTAAGACAGACCTCACCAAACTCGCTCAGCCAGGTGTCGTCGTCTATGGCGATGCC
GGTATTGCGCACACCACGCCGAAAACGATCCAACAAACTGCAGGTAAGAATCTGGTGGCCACCGCTGGCC
AGGATGCCAGTTTCAGCGTATTCCGTCGCTTCTCAGTTGCCGCCGGTGAACTGTTCTCCGTATTTGCGAA
CAAGTTAGGCATCAAGCTCATCGCAGCTGCAGGAAAGGTGCAGCTACAGGCGCAAAAAGACCAGATGGAG
CTGACCTCCTTCGAGGACATGCAGATCACCAGTACCAACGGCCGCATCGTGCTTAACGCCAAAAAAGAGC
TGCTGCTGATGTGTGGCGGAGCTGGGATCCGCATTAAGGATGGAACGATCGAAGAACTTGCTCCTACCCG
TATCACCCAAAAATCGCCGGTACTGGAGTATCAGGGTGGGGACAGCGTGAAGCAGGCGATGCCAACCTTT
AATCAGGGGGACTTTGGTATGAAGTACAAACTACATATCAATGGTGACCCATCGCATGTTCTCAAGAACC
AAAAGTTCCGGGTTCATCGTCAGGATGGCTCTGTCTCTGAGGGTATAACCGATGCAAACGGTGAGTCCTC
TCTGTTGCAAATGAGTGAACTGGAAAATGTCGCCATTGAGTTGATCAAGGGAGTGAAATAA