SecReT6
Protein ID: 379704204
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4852
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]305805..306284 [-]
Producttype VI secretion system effector
NoteTssD
UniProt IDH2J1X3
KEGG IDraq:Rahaq2_4852
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-31, Aligned region: 12..142
Protein Sequence: 159 a.a.     [Download]
>gi|379704204|ref|YP_005220578.1| type VI secretion system effector [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MSNPAYIWLVDENGSPIVGDSLVSGRLGAIELKSVNHNVSIPTDQHTGRLTGTRVHSPISLQKEFDKATP
ILYRALCQGVTLQSATIKMYQITETGTEAEYFNIILDNVKIVAITPNLYPGGQTGTHFENILLHYETITW
KYCDGNIIYKDTWNNRAVA
 
Nucleotide Sequence: 480 bp     [Download]
>gi|379703932|ref|NC_016835.1|:c306284-305805 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGTCAAATCCAGCATATATTTGGTTGGTCGATGAAAACGGATCACCTATTGTGGGAGATTCATTAGTCT
CAGGCAGACTTGGTGCTATCGAGCTTAAGTCAGTAAATCATAATGTGAGCATCCCAACTGACCAACATAC
GGGCCGACTGACCGGGACTCGCGTTCACTCGCCGATATCTTTACAAAAGGAATTTGATAAAGCCACACCT
ATTTTATATCGCGCATTATGCCAAGGCGTGACGCTCCAATCAGCGACAATAAAAATGTATCAAATCACCG
AAACCGGTACTGAGGCAGAATATTTCAATATTATTTTGGATAACGTAAAAATCGTGGCTATTACACCTAA
TTTATATCCTGGCGGCCAAACAGGAACGCACTTTGAAAATATTTTATTGCATTATGAAACGATTACATGG
AAATACTGTGATGGCAACATCATATATAAAGATACTTGGAATAATCGAGCAGTGGCGTAA