SecReT6
Protein ID: 379704214
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4863
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]316147..316626 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDH2J1Y3
KEGG IDraq:Rahaq2_4863
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.40E-51, Aligned region: 8..147
Protein Sequence: 159 a.a.     [Download]
>gi|379704214|ref|YP_005220588.1| type VI secretion protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MSNTQYKLSKARPPRVQITYDVEVGGAESKKELPLVMGVIGNFSKDDMPLRDRRFTHIDKDNFNNVMEGM
KPAVEMLVESTLPEKEGQMAIALEFNSMDDFSPENVAMQVEPLRKLLELREQLSDLRNRTASNDRLKEQL
VELLEGMTKNAEPAKGDAE
 
Nucleotide Sequence: 480 bp     [Download]
>gi|379703932|ref|NC_016835.1|:316147-316626 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
GTGAGCAATACACAATATAAGTTGAGCAAGGCGCGTCCCCCTCGCGTTCAAATTACGTACGACGTTGAAG
TTGGCGGTGCTGAATCCAAAAAGGAATTACCGCTGGTGATGGGAGTTATCGGGAATTTTTCCAAAGATGA
CATGCCGTTACGTGACCGCCGTTTTACGCACATTGATAAAGACAACTTCAATAATGTTATGGAAGGAATG
AAACCGGCTGTAGAAATGTTGGTTGAAAGTACCTTGCCAGAAAAAGAAGGCCAGATGGCTATTGCTCTGG
AATTCAATTCTATGGATGACTTCTCTCCTGAAAACGTGGCGATGCAAGTGGAACCGTTGCGCAAACTTCT
TGAATTGCGCGAGCAACTGAGTGATTTGCGCAACAGAACGGCGAGCAATGACCGCCTGAAAGAACAGTTG
GTTGAATTATTAGAGGGTATGACGAAAAACGCGGAACCTGCCAAAGGAGATGCAGAATGA