SecReT6
Protein ID: 379704215
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4864
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]316623..318104 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDH2J1Y4
KEGG IDraq:Rahaq2_4864
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.70E-181, Aligned region: 65..488
Protein Sequence: 493 a.a.     [Download]
>gi|379704215|ref|YP_005220589.1| type VI secretion protein EvpB [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MSDIQVMNAPAQAEQAGDYLDQIIDNTQAIRRESDRNKVKSQLDNFLSEVASGAVIVSNDLVGSIEARIA
AIDELLSSQVSKIIQAPEFQRMESSWRGLHKLVQSSVTENTKVRVFNCTKKELLRDFKSASDFDQSSLFK
SIYESEYGTFGGDPYSAFVGDFEFDCMPEDVQLLEQISHVAAAAHAPFLSAANPGMFAMGSFSEMPRPRD
LGKLFETSDYARWKSFRQSDDSRYVGLTLPRVIGRLPYGAKTVSVDAFNFEEKIDENNDGSNYLWVNAAY
DLAGRMVEAFEEYSWCAAIRGVEGGGLVKSLPTYNYISQTGEKIMQCPTEVAISDRREKELAELGFIPLI
YCKGTDYAAFFAVQSTNKPRKYDSELANANAKLSSQLQYIMTTSRFAHYLKSIVRDKVGSFMSKSECQNF
LQNWINQYVVGSDNVGPAIKASHPLREAVVEVVDVPGSPGSYRAVAYLKPHFQLEGLSMSLRLVAELPAS
TDA
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|379703932|ref|NC_016835.1|:316623-318104 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGAGTGATATCCAGGTCATGAATGCTCCAGCCCAGGCTGAACAGGCAGGCGATTATCTTGATCAGATTA
TTGATAATACCCAGGCCATCCGCCGGGAATCCGATCGTAATAAAGTAAAAAGTCAGTTGGATAACTTCCT
GTCGGAAGTCGCATCGGGTGCGGTCATTGTCTCCAATGATTTGGTCGGTAGCATCGAAGCGCGCATTGCC
GCCATCGATGAATTGCTGTCTTCTCAGGTCAGCAAAATTATACAAGCACCTGAATTCCAGCGTATGGAAT
CCTCCTGGCGTGGTTTGCACAAGCTGGTGCAAAGCAGCGTCACGGAAAACACCAAAGTGCGCGTTTTTAA
CTGCACAAAGAAAGAGCTGCTGCGTGATTTTAAATCCGCCTCTGACTTTGATCAGTCTTCATTATTCAAA
AGCATTTATGAAAGCGAATACGGCACCTTTGGCGGTGACCCTTACTCTGCTTTTGTGGGTGATTTTGAAT
TCGACTGCATGCCGGAAGATGTGCAACTGCTGGAACAGATTTCACATGTTGCCGCCGCCGCTCACGCGCC
ATTCCTGAGTGCCGCGAACCCTGGCATGTTTGCGATGGGATCCTTCTCCGAGATGCCGCGTCCGCGTGAT
CTGGGCAAACTGTTTGAAACCTCCGACTATGCCCGCTGGAAATCCTTCCGCCAGAGCGACGACTCCCGTT
ATGTTGGCTTAACATTGCCACGTGTTATCGGCCGCCTGCCTTACGGTGCCAAAACCGTGTCCGTAGATGC
GTTTAATTTCGAAGAAAAAATCGACGAAAACAATGATGGCTCGAACTATTTATGGGTAAACGCGGCTTAT
GATTTAGCAGGCCGTATGGTCGAGGCGTTTGAAGAATACAGTTGGTGCGCGGCGATCCGGGGTGTTGAAG
GCGGTGGTTTAGTGAAGTCATTGCCGACCTACAACTACATTTCACAGACCGGCGAAAAGATCATGCAATG
CCCGACAGAAGTGGCAATTTCTGATCGTCGTGAAAAAGAACTCGCTGAGCTTGGTTTTATTCCGCTCATT
TATTGCAAAGGTACAGATTATGCGGCGTTCTTCGCTGTGCAGTCGACCAATAAACCGCGTAAGTACGATT
CTGAGCTGGCGAATGCCAACGCCAAATTATCAAGTCAGCTGCAATATATTATGACAACATCGCGCTTTGC
TCATTATTTGAAATCCATTGTGCGCGATAAAGTGGGCAGCTTTATGTCCAAATCTGAATGCCAGAATTTC
CTGCAAAACTGGATCAACCAATATGTTGTAGGTTCTGACAATGTTGGCCCGGCAATTAAAGCGAGCCATC
CGTTACGTGAGGCTGTTGTTGAGGTTGTGGATGTTCCAGGTTCACCAGGCAGTTATCGTGCAGTCGCTTA
TCTTAAACCTCATTTTCAGCTCGAAGGACTCAGTATGTCACTGCGTTTGGTAGCAGAACTCCCAGCATCT
ACGGATGCGTAA