SecReT6
Protein ID: 379704216
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4865
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]318129..318623 [+]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDH2J1Y5
KEGG IDraq:Rahaq2_4865
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-21, Aligned region: 8..138
Protein Sequence: 164 a.a.     [Download]
>gi|379704216|ref|YP_005220590.1| hemolysin-coregulated protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MSDADNLFMQIEGITGCVSDKKYNGWIAVDYTSNSVFSSAAINNGTGQMNSDGVRFEQVSFSKEMDATST
DLMNMVAEGTNIKKIIVAMNVKTDNKDNEMVRWTYQNCILTSHQIGASKAGGIPHETLSFVFGRIEFETQ
MVEPGGTTKKYGPVGWNIIENTKL
 
Nucleotide Sequence: 495 bp     [Download]
>gi|379703932|ref|NC_016835.1|:318129-318623 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGTCAGATGCTGATAATTTATTTATGCAAATTGAGGGTATTACAGGTTGCGTAAGTGATAAAAAATATA
ATGGCTGGATTGCTGTTGACTATACGAGTAATAGCGTGTTTAGTTCAGCGGCAATCAATAATGGCACTGG
CCAAATGAACAGCGACGGCGTTAGGTTTGAGCAGGTTTCATTCTCAAAAGAAATGGACGCTACTTCCACT
GATCTGATGAATATGGTTGCTGAAGGAACGAATATCAAAAAAATTATTGTCGCGATGAATGTTAAAACGG
ACAATAAAGATAATGAAATGGTCCGTTGGACCTATCAGAACTGCATACTGACCAGCCATCAAATCGGTGC
AAGCAAAGCCGGAGGGATCCCACATGAGACGCTGAGTTTCGTATTTGGTCGCATTGAATTCGAAACCCAA
ATGGTCGAGCCCGGTGGGACAACTAAGAAGTATGGCCCGGTAGGCTGGAATATCATAGAAAACACCAAGC
TGTAA