SecReT6
Protein ID: 379704217
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4866
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]318677..319093 [+]
Producthypothetical protein
NoteTssE
UniProt IDH2J1Y6
KEGG IDraq:Rahaq2_4866
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.90E-10, Aligned region: 27..116
Protein Sequence: 138 a.a.     [Download]
>gi|379704217|ref|YP_005220591.1| hypothetical protein Rahaq2_4866 [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MKSLLQQLSDNNPKDQNDISEEEDKSSTLIDEILLLLSSRPRSYRIDDIPLINESILNYGVSDVFSSDTP
RLERNTIMQSRIQMALQRFEPRLKNVCVTPGEELGSLCSFIINAETLNGEVRYRLMWDDVISQFSLRD
 
Nucleotide Sequence: 417 bp     [Download]
>gi|379703932|ref|NC_016835.1|:318677-319093 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGAAAAGTTTATTGCAGCAATTATCAGATAATAATCCGAAAGACCAAAATGATATTTCTGAGGAAGAAG
ACAAAAGCAGCACGTTAATTGATGAGATATTGCTGCTTTTGTCTTCCCGCCCCCGAAGTTACCGTATTGA
CGATATTCCGTTAATTAATGAGTCGATACTTAATTATGGCGTCAGTGATGTTTTTTCCAGCGATACACCG
CGTCTTGAGCGCAATACCATTATGCAATCACGTATTCAAATGGCCTTGCAACGCTTTGAACCAAGATTGA
AAAACGTCTGCGTGACCCCCGGTGAAGAACTGGGAAGCCTATGTTCATTCATTATTAATGCTGAAACACT
CAATGGTGAGGTTCGCTACCGACTAATGTGGGACGATGTTATCAGTCAATTTTCTCTGCGTGATTAA