SecReT6
Protein ID: 379704218
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4867
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]319106..320908 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDH2J1Y7
KEGG IDraq:Rahaq2_4867
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.10E-167, Aligned region: 7..596
Protein Sequence: 600 a.a.     [Download]
>gi|379704218|ref|YP_005220592.1| type VI secretion protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MLAKKLISYYQNELAYLKTQGKAFARHFPKVARRLGMSEGTSEDPHIERIIESFALVTAQIQQRLDEDMP
EVTDALLTVLAPQFLRPFPSVCIVQMQPDSKVSALTASNRIDAGTALYSRPVNGQVCRFRTIYPVTLQPV
SLYKASLHLDADDMSWSLKIQLSVWPGATLAADSLRLHLSGASRIVNIFYTLLCSEVESLTVFQQGQSYT
LSAQAIRAVGFGENESLLAGDSRVSPTHSLLQDYFFFPQKFHFIDIPLPAGMVAGSQSELSLVVKFNRCM
IARQLEKIAGAVNENLFLLNCTPAVNLFAHRAEPISPDHETAEYPIIPDIRHQDAMEVWSVDSVSAMRKL
GNETQSRPIYPLFGLDHSASDGESGLFWQCMRRETIQNNGVATSLFIAFSDRGESPLAPGCDIVSMNLTC
TNRDIPGAMRNGDPDGDFESELPIAGMKIIALTRPTLPVRPPVKQATRWRLISQLSLNHMLISGPEGARV
LRESLALYNFVDNPGITRLINLILRVDSSPVVTRLAPLDPRSMARGIEIRITFASEAAEEVEYFLLCRFI
DCFLALYAPVNSFTRVITCIDSSGETARTWPVRAGRLSWI
 
Nucleotide Sequence: 1803 bp     [Download]
>gi|379703932|ref|NC_016835.1|:319106-320908 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGTTGGCGAAAAAATTAATTTCTTATTATCAGAATGAACTCGCTTATCTCAAAACGCAGGGAAAGGCGT
TCGCCCGTCATTTTCCAAAAGTCGCCAGACGTTTAGGAATGTCAGAAGGCACGTCAGAAGATCCGCATAT
TGAGCGAATTATTGAATCCTTTGCGCTGGTCACGGCGCAGATTCAGCAACGTCTCGATGAGGATATGCCG
GAAGTGACTGATGCATTACTGACGGTGCTGGCCCCGCAATTTCTGCGTCCTTTTCCTTCGGTTTGCATCG
TACAGATGCAGCCGGATAGTAAAGTCAGTGCGCTGACCGCCAGTAACCGCATTGACGCCGGAACGGCATT
ATATTCCCGTCCGGTGAACGGGCAGGTTTGCCGTTTCCGCACCATTTATCCGGTTACGCTTCAGCCTGTC
AGTCTGTATAAAGCCAGCCTGCATCTGGATGCTGATGACATGAGCTGGAGTCTGAAAATACAGTTGTCGG
TCTGGCCTGGTGCCACACTGGCGGCGGATTCTCTGAGGTTGCATCTCAGCGGCGCCAGTCGCATCGTAAA
CATCTTTTATACCTTGTTGTGCAGCGAAGTTGAATCACTGACAGTTTTCCAGCAAGGGCAGAGTTATACG
CTGTCAGCGCAGGCTATCCGTGCCGTGGGTTTCGGCGAAAATGAAAGTCTGCTTGCCGGTGATTCGCGGG
TTTCACCCACTCACAGCTTGCTGCAGGACTATTTCTTCTTTCCGCAAAAATTTCATTTTATTGATATACC
GCTGCCTGCTGGCATGGTGGCGGGGAGTCAAAGCGAGCTTTCACTGGTGGTGAAATTTAACCGCTGCATG
ATAGCGCGCCAACTGGAGAAAATAGCCGGTGCGGTGAACGAAAACCTGTTTCTGCTCAACTGTACGCCTG
CTGTGAATCTTTTCGCCCACCGGGCCGAACCGATTTCACCTGATCACGAAACAGCAGAGTATCCGATTAT
TCCAGACATTCGTCATCAGGATGCGATGGAAGTCTGGTCTGTAGACAGCGTGTCGGCGATGCGCAAGCTG
GGCAATGAAACGCAGTCCCGCCCGATATATCCGTTGTTTGGTTTAGACCATTCAGCCAGCGACGGTGAAA
GCGGTTTGTTCTGGCAATGTATGCGCCGCGAAACCATCCAAAATAACGGTGTCGCCACATCGTTATTTAT
CGCCTTTTCTGACCGGGGAGAAAGCCCGTTAGCGCCTGGTTGCGACATCGTCAGCATGAATCTGACCTGC
ACCAATCGTGATATTCCGGGAGCCATGCGCAACGGCGATCCTGATGGCGATTTCGAATCAGAGCTGCCGA
TTGCGGGGATGAAAATTATCGCGCTGACACGCCCGACGCTGCCGGTCAGGCCGCCGGTGAAACAGGCTAC
GCGCTGGCGTTTGATTTCTCAGCTTTCACTCAACCATATGCTGATCAGCGGACCGGAAGGAGCCCGTGTA
CTCAGGGAGTCACTGGCGCTGTACAACTTTGTCGATAATCCAGGTATTACCCGTTTAATTAACCTGATCC
TGCGTGTTGATTCCAGCCCGGTCGTTACCCGGCTGGCGCCATTGGATCCCCGTTCTATGGCGCGGGGGAT
TGAGATCCGCATTACCTTTGCCAGCGAAGCGGCCGAAGAAGTCGAGTATTTCCTGCTGTGTCGCTTTATT
GATTGTTTCCTGGCGTTGTACGCACCGGTTAATAGTTTCACTCGGGTGATCACCTGCATTGACTCATCGG
GTGAAACTGCACGGACATGGCCTGTGCGGGCAGGAAGACTGTCATGGATCTAA