SecReT6
Protein ID: 379704219
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4868
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]320899..321846 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDH2J1Y8
KEGG IDraq:Rahaq2_4868
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-68, Aligned region: 10..296
Protein Sequence: 315 a.a.     [Download]
>gi|379704219|ref|YP_005220593.1| type VI secretion protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MDLSNILSPHNFFQQVRLMLRRLTRTQGKNSQQALETQLYFISPLSLDAPKGDITSITPLDQQRWQVEVA
AHGLTGALGALPTVYTEWMIDRYYRHGDKTAKAFLDIFNHRLHSLRYLAWQKYHYYAMAEFSATRPLSQA
IHALSGVANSTPSQQQEQFADLFAHSVRSMLNVETWLKHRFSVAAKVTPFTGGWQVMDQAQCCRLGEPSQ
TLAAAPMLGSVYWDRQSHFTVTLGPVPMKNAGLFLPKGKHYQNLWSHLREYVGQGLDFDIDLLIDNTANV
VTPLGSGQLGLDICLGPSGGAGQHKIRLPVCREGK
 
Nucleotide Sequence: 948 bp     [Download]
>gi|379703932|ref|NC_016835.1|:320899-321846 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGGATCTAAGTAATATCCTCAGTCCGCATAACTTTTTCCAGCAGGTGAGGCTGATGTTACGCAGGCTGA
CCAGAACACAGGGAAAAAACAGCCAACAGGCACTGGAAACGCAGCTTTATTTCATTTCGCCGCTCTCACT
GGATGCGCCGAAAGGTGACATTACGTCAATAACCCCGCTGGATCAGCAGCGCTGGCAAGTGGAAGTAGCG
GCCCACGGACTGACAGGGGCACTGGGCGCGTTACCGACGGTATACACCGAGTGGATGATCGACCGCTATT
ACCGCCATGGCGACAAAACAGCCAAAGCTTTTCTGGACATTTTTAATCACAGGTTGCATAGCCTGCGCTA
TCTCGCCTGGCAGAAATATCACTATTACGCCATGGCGGAATTCAGTGCAACACGGCCGCTGAGTCAGGCC
ATTCATGCATTATCCGGTGTGGCAAACAGTACACCATCTCAGCAGCAGGAGCAGTTTGCGGATTTATTTG
CGCATTCAGTGCGCTCAATGCTCAACGTTGAAACCTGGTTAAAACACCGCTTTTCCGTGGCGGCGAAAGT
CACGCCTTTTACCGGCGGATGGCAGGTGATGGATCAGGCGCAGTGTTGTCGGTTGGGGGAACCGTCACAA
ACGCTGGCCGCAGCCCCCATGCTTGGCAGCGTGTACTGGGACCGGCAGTCACATTTTACGGTGACGCTGG
GGCCGGTGCCGATGAAGAACGCCGGTCTTTTTTTGCCTAAGGGAAAGCACTACCAAAATTTGTGGTCGCA
TCTGCGCGAATATGTTGGTCAGGGTCTGGATTTCGATATTGATCTGCTGATCGACAATACAGCGAACGTC
GTTACCCCGCTGGGAAGCGGGCAACTCGGGCTGGATATTTGCCTCGGGCCTTCCGGGGGTGCAGGCCAGC
ATAAAATTCGTTTACCCGTCTGCCGGGAAGGAAAATAA