SecReT6
Protein ID: 379704220
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4869
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]321850..323763 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDH2J1Y9
KEGG IDraq:Rahaq2_4869
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-56, Aligned region: 31..325
Phage_base_V [PF04717], Evalue: 1.20E-22, Aligned region: 359..451
DUF2345 [PF10106], Evalue: 0.0011, Aligned region: 493..624
Protein Sequence: 637 a.a.     [Download]
>gi|379704220|ref|YP_005220594.1| Rhs element Vgr protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MSNVVGQDNRFIRFVGSAADSLTLMHIEGDEQFSDTFSYQIRFRTSLITPQMGRFLGHEMACEIGRGNQK
RYVHGVLTHIEEDNSVNGISTFTGTLEPRMALLRLGRNLAVFQNITVPDLVCKLLRQQNISHIDLRLRAT
YQPREYCIQYRESDFDFISRLLEQEGIYYFFQHDAGQHTLVLADHPSSHQSGKTAELPFMPLQGRGDGVG
ILNWVACSSLAASSVMLKGFNMVQAASVEGESKAVDADYSVPGVSYVDAHGHEKRELLQSEARLKMEQLE
ADNQLFYAEASVWGLGCGDKFLLSGHPSCQGNYRIKSVHMHASSNIDDGQPDFGCALTVLKDSLSWRPPC
LTRQPEIAGILTAIVVGPKSEEVHTDEYGRIKIQFPWDRENKHDDGSSCWVRVSQSWAGGRFGAMFLPRV
NSEVTVSFVHGNPDYPLVTGSVYNGQNKPPLSLPEEKNHAGFVSRSSLNGNVEEGHELRFDDKKGEERLL
ITSQKDLLLTVKNDVTTRITKNVNETIGENRTTELTKGNENLTLKQGDYVLDIKGNLQESLTSGNHQLNI
SGGGSTVKADKACVIESTQSIELKVGSSKITLSPSGITLSGTTIKIEGKGTAELKGAMVTVQGSGMTQIK
GGVTMIG
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|379703932|ref|NC_016835.1|:321850-323763 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGTCGAACGTAGTAGGACAAGACAACCGGTTTATCCGTTTCGTTGGCAGTGCCGCTGATTCACTGACGC
TGATGCATATCGAAGGCGATGAACAATTCTCTGACACCTTCAGCTACCAGATCCGGTTTCGCACGTCGTT
AATCACTCCACAGATGGGACGTTTTTTGGGGCATGAAATGGCCTGTGAGATTGGCCGGGGCAACCAAAAG
CGCTACGTGCATGGTGTACTGACACACATTGAAGAAGACAATAGTGTCAATGGCATCAGCACCTTCACCG
GCACGCTGGAACCGCGAATGGCGCTGCTGCGTCTCGGGCGTAATCTGGCCGTTTTCCAGAATATTACCGT
GCCAGATTTAGTGTGCAAACTGCTTCGTCAGCAGAACATCAGCCACATTGATTTACGCCTGCGTGCGACT
TATCAGCCGCGTGAATACTGTATTCAGTATCGCGAATCCGATTTTGACTTCATTAGTCGTCTTCTCGAGC
AGGAAGGGATCTATTACTTTTTCCAGCATGATGCCGGGCAACATACCCTGGTACTGGCTGATCACCCGTC
CAGCCATCAGTCGGGTAAAACGGCGGAGTTACCTTTTATGCCACTGCAGGGGCGAGGCGATGGTGTCGGT
ATCCTGAACTGGGTGGCCTGTTCTTCGCTGGCAGCCTCTTCCGTAATGCTTAAAGGTTTTAACATGGTGC
AGGCAGCCAGTGTGGAAGGCGAATCGAAAGCGGTGGACGCGGATTATTCCGTGCCGGGTGTCAGCTATGT
GGATGCGCACGGCCATGAAAAACGCGAATTACTGCAATCTGAAGCCCGGCTGAAGATGGAACAGCTTGAG
GCAGATAATCAGCTGTTTTACGCCGAGGCCAGCGTGTGGGGGTTAGGTTGCGGCGATAAATTCCTTCTGA
GCGGACACCCTTCCTGTCAGGGAAACTACCGAATCAAGTCGGTTCATATGCATGCATCAAGCAACATTGA
TGACGGGCAGCCTGATTTTGGCTGCGCGCTCACGGTACTGAAGGACAGCCTTTCCTGGCGTCCGCCGTGC
CTCACCAGACAACCTGAAATCGCCGGTATTCTGACAGCCATCGTTGTCGGACCGAAGTCAGAAGAAGTCC
ACACGGACGAATATGGTCGCATCAAAATTCAGTTCCCGTGGGATCGTGAAAATAAACATGACGATGGCAG
TTCCTGTTGGGTGCGGGTTTCGCAGTCGTGGGCGGGCGGACGTTTCGGTGCCATGTTCCTGCCTCGCGTC
AACAGCGAAGTTACCGTCAGCTTTGTGCATGGCAACCCTGATTATCCTCTGGTGACCGGCTCGGTATACA
ACGGGCAAAACAAGCCGCCGCTGAGCCTGCCTGAAGAGAAAAATCATGCCGGATTCGTTTCACGCAGTTC
CCTCAATGGCAATGTTGAAGAAGGCCATGAATTGCGCTTCGACGATAAAAAAGGCGAAGAGCGTCTGCTC
ATCACCTCGCAAAAAGATCTGCTGCTGACGGTAAAAAACGATGTCACCACCCGTATTACCAAAAATGTCA
ATGAAACCATTGGTGAGAACCGCACGACCGAGTTAACCAAAGGTAATGAAAACCTGACACTCAAACAGGG
CGATTATGTCCTGGATATTAAAGGCAACCTGCAGGAAAGCCTGACCAGCGGTAACCATCAGCTAAACATC
AGCGGTGGCGGCAGCACGGTCAAAGCGGATAAAGCCTGCGTTATTGAATCCACCCAGTCTATCGAATTAA
AAGTCGGTAGCAGCAAAATTACCCTTTCTCCTTCCGGCATTACGCTGAGCGGCACCACGATCAAAATTGA
AGGGAAGGGCACGGCAGAACTTAAAGGCGCGATGGTCACTGTTCAGGGTAGTGGTATGACCCAGATCAAG
GGCGGCGTGACGATGATTGGCTGA