SecReT6
Protein ID: 379704223
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4872
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]324603..325667 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDH2J1Z2
KEGG IDraq:Rahaq2_4872
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.80E-19, Aligned region: 55..115
ImpA-rel_N [PF06812], Evalue: 5.80E-19, Aligned region: 201..217
Protein Sequence: 354 a.a.     [Download]
>gi|379704223|ref|YP_005220597.1| type VI secretion-associated protein, ImpA family [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MIMNFEPLFAPVSAEQPAGRNMEYEQVYNEIREARESDPDYLPQGEWATELRKADWSKVVRLSSQVLQKE
SKDLQVACWLIEGLSHQHGISGLLGGIGFLIPFIQNYWQNGWPEMDEDGAVIRHGMINRLDRQLAQMMHC
HPLFGQPESTLDHWRKVLAYEHRVTMKPDSAAERGSDDDFSMDTFNRWAATLDPQKVIAQNEALTQLETT
LDTLEALYGQLNPQADSLAMGQMRSATAEMQEFVKRLFDRAAPAYDDVMTLNVLTPDEDEQGTDVSSLMN
NTKKQTMSRDLAISQMLTIAHFFRQTEPSSPVPFLMERAARWAAMTLTEWLEEMLQDDSSMRDINKVLKG
HGRE
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|379703932|ref|NC_016835.1|:324603-325667 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGATAATGAATTTTGAGCCCTTGTTCGCCCCGGTCAGCGCTGAACAACCTGCTGGCCGCAACATGGAAT
ATGAACAGGTCTATAACGAAATCCGCGAGGCGCGGGAAAGTGATCCTGACTATTTGCCGCAGGGCGAATG
GGCTACTGAATTGCGTAAAGCCGACTGGAGCAAAGTCGTCCGCTTAAGCTCGCAAGTGCTACAGAAAGAA
AGCAAGGATTTGCAGGTGGCCTGCTGGCTTATTGAAGGTCTGAGCCATCAGCACGGGATCAGCGGCCTGC
TGGGCGGTATCGGTTTTCTGATACCGTTTATACAAAATTACTGGCAAAACGGCTGGCCGGAGATGGATGA
GGACGGCGCGGTAATCCGCCACGGCATGATCAATCGCCTGGATCGCCAGCTGGCGCAGATGATGCATTGT
CATCCTCTGTTCGGGCAGCCGGAAAGCACACTGGATCACTGGCGTAAGGTGCTCGCCTATGAACACCGGG
TGACGATGAAACCAGATAGCGCTGCCGAACGAGGCAGTGACGATGATTTCTCTATGGATACGTTCAACCG
CTGGGCCGCCACACTGGATCCGCAGAAAGTTATCGCGCAGAACGAGGCGTTAACCCAACTGGAGACCACG
CTGGATACGCTTGAAGCCCTCTATGGTCAGCTGAATCCGCAGGCCGATTCTCTGGCGATGGGGCAGATGC
GCAGTGCAACCGCTGAAATGCAGGAATTTGTGAAACGCCTGTTTGACCGTGCGGCACCGGCTTATGACGA
CGTGATGACCCTTAACGTATTAACGCCTGACGAAGATGAGCAGGGCACTGACGTCAGCTCACTGATGAAT
AACACTAAAAAACAAACGATGTCACGGGATCTGGCCATCAGCCAGATGCTGACCATTGCCCATTTTTTCC
GCCAGACCGAACCGTCAAGCCCCGTCCCTTTTCTGATGGAGCGTGCGGCGCGCTGGGCAGCGATGACACT
GACGGAATGGCTGGAAGAGATGTTGCAGGACGACAGCAGTATGCGTGATATCAACAAAGTACTGAAAGGG
CACGGCAGAGAATGA