SecReT6
Protein ID: 379704224
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4873
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]325694..326239 [+]
Producthypothetical protein
NoteTssJ
UniProt IDH2J1Z3
KEGG IDraq:Rahaq2_4873
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.20E-20, Aligned region: 5..165
Protein Sequence: 181 a.a.     [Download]
>gi|379704224|ref|YP_005220598.1| hypothetical protein Rahaq2_4873 [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MLGVMLLTGCASDNDQGRQKAISEVAAPFANGAITLKLRAEPGLNSLNEMPNSCTVLLLQARDKPTLDKI
LGNPATLKSLFAGAGSEGDVLQVDRYVMMPGQTNTVHIDRARDTRNVALVAGYYPFPMKKHMVSAGVPVE
SESTGWWEPVWQAHLAPVTLSVTLGSESIVSSDVPVAGEKK
 
Nucleotide Sequence: 546 bp     [Download]
>gi|379703932|ref|NC_016835.1|:325694-326239 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGCTCGGTGTCATGCTGCTGACAGGTTGTGCGTCTGATAATGATCAGGGCCGTCAGAAGGCGATCAGCG
AAGTGGCTGCGCCTTTCGCCAACGGGGCTATCACGCTGAAATTGCGGGCGGAACCGGGGCTGAACAGCCT
CAATGAGATGCCCAACAGTTGTACGGTATTACTGCTGCAAGCCAGGGATAAACCGACGCTGGATAAAATT
CTGGGTAACCCCGCGACGCTGAAAAGTTTGTTTGCTGGTGCCGGCAGCGAAGGCGACGTTTTGCAGGTAG
ATCGTTACGTCATGATGCCGGGACAAACCAACACAGTGCATATCGACCGCGCCAGGGATACCCGCAATGT
GGCGCTGGTGGCGGGCTATTATCCGTTCCCGATGAAGAAACACATGGTCAGCGCAGGGGTGCCGGTGGAG
TCTGAAAGTACAGGCTGGTGGGAACCAGTCTGGCAGGCGCATTTAGCGCCGGTCACCCTTTCTGTCACCT
TAGGCAGTGAAAGCATTGTCAGTTCAGATGTTCCTGTTGCCGGAGAGAAAAAATAA