SecReT6
Protein ID: 379704225
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4874
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]326239..327633 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDH2J1Z4
KEGG IDraq:Rahaq2_4874
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.00E-87, Aligned region: 20..461
Protein Sequence: 464 a.a.     [Download]
>gi|379704225|ref|YP_005220599.1| type VI secretion protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MYPEQQQIYWHSGLYLQPQHFQSLDLHYEWNLAEHLRLAQPYNYGLIEVSINEAALNDYVISVEQIRCIL
PGGTLLSQPGNSRVEQRNFRDFWKQRDQPMTLWLAVRRFDPLHSNVTTLEKEHDRAVTRWINTSEERVMK
DVYDHAPDAAVARLCYNVRLLTDIEKDDAVDCECIPLTRLRYENERVILDPTFSPPSVTLFGSFSLGKLI
DTIYFELSARARKLEEYKRSERLVSDAERGDQVTQLLAMRSLNRVLPQLKNFCQARQVHPWQVYNMLCQL
VGDLSSFNDSCSFLGEWHDGENPLQTYNHNDLLSCFESARKTLITLLNSLVLEDNTYITLENDLQGVFTG
NFDSMQSKNAETVLLLLRSASMPMENRQIKNPGGIKLASPKMIEPLIQHALPGIPVIRCPQPPRGVPNRS
DSHYFLVEQDSELWNKARQHNSISFYWPDMPEDLQVQIIFVVPS
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|379703932|ref|NC_016835.1|:326239-327633 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGTATCCAGAACAACAGCAGATTTACTGGCATTCGGGGCTTTATCTGCAACCGCAGCATTTTCAGTCAC
TTGACCTGCATTACGAATGGAACCTCGCGGAGCATTTGCGTCTGGCACAGCCCTATAATTACGGGCTGAT
TGAGGTCAGTATTAATGAAGCGGCACTGAACGATTATGTGATCAGTGTCGAGCAGATCCGTTGTATTTTA
CCCGGCGGTACTCTGCTGTCTCAGCCCGGTAACAGCCGCGTAGAACAACGTAACTTCCGTGATTTCTGGA
AACAGCGCGATCAGCCAATGACCCTCTGGCTGGCTGTACGTCGTTTTGATCCGCTGCACAGCAATGTCAC
CACGCTGGAAAAAGAGCACGATCGCGCCGTCACGCGCTGGATCAACACCAGCGAAGAGCGGGTGATGAAA
GATGTCTATGACCATGCGCCGGACGCCGCAGTGGCCCGCTTGTGCTACAACGTCAGATTGCTGACGGACA
TTGAAAAAGACGATGCGGTTGATTGCGAATGCATTCCACTCACCCGTCTGCGTTATGAAAACGAACGGGT
GATCCTCGATCCAACATTTTCGCCACCTTCCGTAACGCTTTTTGGATCATTCAGCCTCGGCAAGCTGATT
GACACTATCTATTTCGAACTGAGTGCGCGGGCCAGAAAGCTTGAAGAATACAAACGCTCAGAGCGACTGG
TCAGCGATGCCGAGCGTGGCGATCAGGTGACACAGTTGTTAGCTATGCGCTCTCTCAACCGGGTATTGCC
TCAACTGAAAAATTTCTGTCAGGCACGTCAGGTTCATCCGTGGCAGGTCTATAACATGCTGTGCCAGCTG
GTGGGCGATCTTTCCTCATTCAATGACAGCTGCTCCTTTCTGGGAGAGTGGCATGACGGCGAAAATCCGC
TGCAAACCTACAACCACAATGATTTGCTGAGTTGTTTCGAGAGTGCCCGTAAGACGCTGATTACCCTGCT
GAACAGTCTGGTACTTGAAGATAATACCTACATCACACTGGAAAACGATCTTCAGGGCGTGTTCACCGGA
AACTTTGACAGCATGCAGAGTAAAAATGCCGAAACGGTACTGCTGCTGTTACGTTCTGCCAGCATGCCGA
TGGAAAATCGTCAGATCAAAAATCCGGGCGGCATCAAACTGGCCTCGCCAAAAATGATCGAACCGCTGAT
CCAGCATGCTCTGCCGGGCATCCCGGTGATCCGTTGTCCACAGCCACCGCGTGGCGTGCCAAACCGCAGC
GATTCGCATTATTTCCTCGTCGAGCAGGACAGCGAATTGTGGAATAAAGCCCGGCAGCACAACAGCATTT
CCTTCTATTGGCCTGATATGCCGGAAGATCTTCAGGTGCAGATTATATTTGTGGTGCCATCATGA