SecReT6
Protein ID: 379704226
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4875
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]327630..328253 [+]
Producthypothetical protein
NoteTssL
UniProt IDH2J1Z5
KEGG IDraq:Rahaq2_4875
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.30E-25, Aligned region: 3..198
Protein Sequence: 207 a.a.     [Download]
>gi|379704226|ref|YP_005220600.1| hypothetical protein Rahaq2_4875 [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MMSLLNCYLPLFRYVTAFFIHPQEYPDYNAFREKSITLLQQALLESERHHETTECEDAYFAVVLWVDERV
LRSRADWVKEWRGDLLQKYYFDISVGGEAFFDRLDETDKNNIQLRMVYLFCLLMGFHGKYTSQDAQLLQQ
RIEDERQCLPQAWRQWPNDALLVEQDTGGEKNKTVVKRLRQRKGLLLALPVIIYLVILSTGLGIFFR
 
Nucleotide Sequence: 624 bp     [Download]
>gi|379703932|ref|NC_016835.1|:327630-328253 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGATGAGTTTACTCAATTGTTATTTACCGTTGTTTCGTTATGTGACGGCGTTTTTTATTCATCCGCAGG
AATATCCGGACTACAACGCGTTTCGCGAAAAAAGCATTACCTTATTACAACAGGCGCTGCTGGAATCAGA
ACGTCATCATGAAACGACCGAATGCGAGGATGCCTATTTTGCGGTGGTATTGTGGGTGGATGAGCGGGTA
TTACGATCCCGCGCGGATTGGGTGAAAGAATGGCGGGGGGATCTTTTGCAGAAATATTATTTTGATATTT
CTGTCGGTGGTGAAGCATTTTTCGACCGGCTGGATGAAACCGATAAAAATAATATACAGCTGAGAATGGT
GTATTTGTTCTGTCTGCTGATGGGTTTTCACGGAAAATACACCTCACAGGATGCGCAGCTTTTGCAACAG
CGCATCGAAGATGAGCGGCAGTGTTTGCCACAGGCCTGGCGTCAGTGGCCGAATGATGCTTTGCTGGTTG
AACAGGACACAGGCGGTGAAAAAAATAAAACGGTAGTGAAAAGATTACGCCAGCGTAAAGGGCTGTTGCT
TGCATTGCCTGTGATCATTTATTTAGTGATTCTTTCCACCGGCTTAGGGATATTCTTCAGGTAA